KEGG   Cyanothece sp. PCC 8802: Cyan8802_4060Help
Entry
Cyan8802_4060     CDS       T00968                                 

Definition
phosphodiesterase/alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cyh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4181462..4183183)
Genome map
AA seq 573 aa AA seqDB search
MPNIASGDTNQNSSVLWTQSNHIGNVTFEYSTDPNFATIAGKITQIITDINLPVKVSVTG
LTPETQYYYRVTDANSQTTLGTFKTAAEIGQQKGLKFGVSGDWRGELSPYPAIANADEQN
LDFFILHGDTIYADYPSPAVNKSQAETITDFRLKYQEVYGDRFGLNTWGDLRSSTSIFAI
IDDHEVTNDFAGGADVSTDSRFSDSPGILINESTLYQTGLQAFQEYHPIKNQTYANTGDR
RTENKPKLYRSTTYGKDAQIIILDNRSFRDQVLPNVTNPSDSAQVNQFLTNSFNPSRTML
GKAQLDDLKHDLLTAHNNGVTWKFILVPEPIQNLGVIFASDRFEGYTAERTEILKFIDEN
NINNVVFIAADIHGNLVNNLTYQLSPNSQQIPTNSFEVTTGSVAFNAPFGPSVIGLASQL
KLLTPQQVAFYNSLTTRDAKDNFIRQLVDQQITPFGYDPLGLDNNLSQANGLINAQLIEG
GYVNTHTYGWTKFDIDQNTQRLTVTTYGIDPYTEAELTPNSPVLTRNPVIINQFEVTPTK
TPKPSFSLSLLIVFAICSLCFLPSIISSIFKEK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatattgccagtggagatactaaccaaaattctagtgttttatggacgcaaagt
aatcatattggaaatgtcacttttgagtattcaactgatcctaatttcgcaacaattgca
ggaaaaatcacccaaatcataaccgatattaatctcccagttaaggtttctgtgacgggt
ttaaccccagaaactcaatattattatcgagttactgatgctaacagccaaaccaccctt
gggactttcaaaacggcggcagaaattggacagcaaaaggggttaaaatttggcgtttct
ggagactggagaggtgaattaagtccctatccagctattgccaatgctgatgaacaaaac
ttagactttttcatcttgcatggggatactatttatgctgattatccctcccctgctgtt
aacaaatcccaagcagaaaccataacagattttcgtctaaaatatcaagaagtttatggc
gatcgcttcggactaaatacttggggagacttgcgatcttctacctcaatttttgctatc
attgatgaccacgaagtgaccaatgatttcgcaggaggggctgatgtttccaccgattca
agatttagcgattccccaggaatattgattaatgaaagtactctttatcagactgggtta
caagcgtttcaagaataccatcctatcaaaaatcaaacctatgctaacacgggtgatcgc
cgtactgaaaataaacctaaattgtatcgttctacaacctatggtaaggatgcccagatt
atcattttagataaccgttcttttcgagatcaagttctacctaatgttaccaatcctagc
gattcagcacaagtaaatcaatttctcaccaattcctttaacccttctcgaaccatgtta
ggaaaggcgcaacttgatgatctcaaacatgatttattgacggcacacaataacggagtg
acttggaaatttattctggttcctgaacctatccaaaatttaggggtaatctttgcttca
gatcgctttgaaggttacaccgcagaacgaaccgaaatcctcaaattcattgatgaaaat
aacattaataatgttgtctttattgcggcggatattcatggtaatttagtcaataattta
acctatcaactctctcccaatagccaacaaattcctactaattcctttgaagtgaccacg
ggatcggttgcttttaatgccccctttggtccgagtgtcattgggttagcttctcagtta
aaactattaactcctcaacaggttgctttttataattccctcacaacaagggatgctaaa
gataattttattcgacaattagttgatcaacaaatcacaccttttggctacgatcctttg
gggttagataacaatttatctcaggctaacggattaattaatgctcaacttattgaagga
ggatatgttaacacccacacctacggttggacaaaatttgacatcgatcaaaatactcaa
agattgacagtaaccacctatggcattgatccctatactgaggctgaactgacaccaaat
agtccggttttaacgagaaatcctgtgattatcaatcaatttgaggtaactcctacaaaa
acccctaaaccttccttctctttaagtttattaatagtttttgctatctgtagtttatgc
tttttaccctcaattatctcatcaatttttaaggagaaataa

DBGET integrated database retrieval system