KEGG   Cyanothece sp. PCC 8802: Cyan8802_4066Help
Entry
Cyan8802_4066     CDS       T00968                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan8802_4066
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan8802_4066
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan8802_4066
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan8802_4066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(4188921..4190219)
Genome map
AA seq 432 aa AA seqDB search
MTQATQTQTKAATFTHLVSKEGGVKYPLKALHVCEETFSPLEVAYDYDAIRAQVTRESIQ
AGPNSIWRYKAFLPVESENPIDVGTGMTPLVKSHRLARRLGLKNLYIKNDAVNMPTLSFK
DRVVSVALTRAKELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTLI
YNPTVMAVKGNYDQVNRLCCEVGNSYGWGFVNINLRPYYSEGSKTLGFEVAEQLGWKLPD
HVVAPLASGSLYTKIYKGFQEFIKTGLVEDKAVRFSGAQAEGCSPIAAAFKEGRDFVTPV
KPNTIAKSIAIGNPADGYYALDIARKTNGNIESVTDAEIVEGIKLLAETEGIFTETAGGT
TIAVLKKLVEAGKIDPEETTVVYITGNGLKTQEAVQEYIGQPLIIEPKLDSFERALERSR
TLERLEWQQVLV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcaactcaaacccaaaccaaagccgccacctttactcatcttgtttctaaa
gaaggtggcgttaaatatcccctcaaagcccttcacgtttgcgaggaaaccttctctccc
ctggaagtggcctatgattacgatgccatccgtgcccaagtgacccgcgaaagcatccaa
gctggacccaactccatttggcgttacaaagcgtttttgcccgtagaaagcgaaaatccc
attgatgttggcaccgggatgacccccctcgttaaatcgcaccgtttagcccgtcgcctg
ggtctaaaaaatctttatatcaaaaacgatgccgtcaatatgcccaccctcagcttcaaa
gatagggtggtgtccgttgctctcactagagccaaagaactgggatttaccaccgtttcc
tgcgccagtacggggaatttagccaattctacagcagcgatcgccgcccatgcagggtta
gactgttgcgtgttcattccggcagatttagaagcgggtaaagtcctgggtactctcatc
tacaatccgaccgtgatggccgtcaaagggaactacgaccaagtgaaccgtctctgctgc
gaagtgggtaacagctacggatggggctttgttaacatcaatttacgtccctactactcg
gaagggtcaaaaacgctaggatttgaagtggccgaacaattagggtggaaactccctgat
cacgtcgttgctcccttagcgtcgggttccctctacaccaagatttacaaaggcttccaa
gagttcatcaaaaccgggttagtcgaagataaagcggttcggttcagtggagcccaagcg
gaaggttgttctcccattgcggctgcgtttaaagaaggtcgggactttgtaaccccagtt
aaacccaatactattgctaaatccatcgctattggtaatcctgctgatggttattacgcc
ttagatattgcgcgtaaaaccaacgggaatattgaaagcgtcaccgatgcagagatcgtc
gaagggattaaacttttagcggaaaccgaaggcattttcacggaaaccgcagggggaact
accattgcggtcctcaaaaaactggtagaagcgggtaaaattgatcctgaagaaactacc
gtagtttatatcaccggaaacggattaaaaacccaagaagcggtgcaagagtacatcggt
caacccctaattatcgagcctaaattagacagttttgaaagagccctggaacgttctcgg
actctagaacgtctagaatggcaacaggttttagtttag

DBGET integrated database retrieval system