KEGG   Cyanothece sp. PCC 8802: Cyan8802_4382Help
Entry
Cyan8802_4382     CDS       T00968                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan8802_4382
Enzymes [BR:cyh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan8802_4382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4528849..4532841
Genome map
AA seq 1330 aa AA seqDB search
MFTHVKSTIRHIVPKAINGRSLLKVVYVVLEPQYQSSLSAAVNAINSNNPKLAIEISGYL
IEELRNPENYEEFKRDIANANLFIASLIFIEDLADKVVEAVKPHRDNLDAVVVFPSMPQV
MRLNKLGSFSMAQLGQSKSAIAQFMRKRKENSGAGFQDAMLKLLRTLPQVLKYLPVEKAQ
DARNFMLSFQYWLGGSAENLENFLLMLAHKYSYPDLLQDKTVDYKDPVVYPDMGIWHPLS
MQMFEDVPSYLQWFNSRTDISDNLKDPLAPCVGLILQRTHLVTGDDAHYVAMVQELECMG
ARVIPVFAGGLDFSKPVEAYFWDRSVKGIEPVAIVDTVVSLTGFALVGGPARQDHPKAIE
SLKRLNRPYMCALPLVFQTTQEWEASDLGLHPIQVALQIAIPELDGAIEPIILSGRDGNT
GRAIALQDRIEAVAQRALKWANLRKKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSIY
EVMKALKGNGYDVQELPDSPKALMEAVIHDAQAQYASPELNIAYRMSVEQYERLTPYSVR
LEENWGPPPGHLNSDGQNLLIYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAA
YYTYLNQVWKADAVLHFGTHGSLEFMPGKQMGMSGECYPDSLIGMIPNLYYYAANNPSEA
TIAKRRSYAETISYLTPPAENAGLYKGLQELSELIGSYQTLKDSGRGIPIVNTIMDKSRL
VNLDQDIALPDTDAKDMTSEERDNIVGLVYRKLMEIESRLLPCGLHVIGKPPSAEEAIAT
LVNIAALDREEEGITSLPRIIANSVGREIEEVYQNSDRGILEDVELLQQITLATREAVSA
LVKEQIDAEGRVSFVSKLNFFNMGKKTPWVETLHNLGYKNVDQDALKPLFEYLEFCLEQV
CADNELGGLLKALEGEYVLPGPGGDPIRNPNVLPTGKNIHALDPQSIPTLAAVKSAKIVV
DRLLARQKIDNGGNYPETIACVLWGTDNIKTYGESLAQIMWMVGVKPVPDALGRVNKLEL
ISLEELGRPRIDVVVNCSGVFRDLFINQMNLLDQAVKMAAEANEPLEMNYVRKHALQQAE
EMGINLRQAATRIFSNASGSYSSNVNLAVENSSWEEEKELQDMYLNRKGFAFDSDNPGVM
NDNRKVFEAALKTADATFQNLDSSEISLTDVSHYFDSDPTKVVASLRGDGKKPAAYIADT
TTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATADAVD
NWVYEDVNTTFIQDEEMCKRLMNLNPNSFRKMVGTLLEVNGRGYWETSQENLDKLQELYQ
EVEDRIEGVE
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccacgtcaagtccaccattcgccatatcgttccaaaggcaattaatggtcgt
tctttgcttaaggtggtctatgtcgtcttagaacctcagtatcagagttctctatcggcg
gctgttaatgctatcaatagtaataatcccaagttagccatagaaattagtggttattta
atcgaagaactgagaaaccccgaaaactacgaggaatttaagcgagatatagctaatgca
aacctttttatcgcatcgttgatcttcattgaagacctagcggataaagtggtcgaagca
gtcaaaccccatcgggataacttagatgcggtggtggttttcccctccatgccccaggta
atgcgcttaaataaattgggtagcttttccatggcccagttgggacagtctaagagtgcg
atcgcccaatttatgcgaaaacgcaaagaaaattcgggtgcagggttccaagatgctatg
ttaaagctattgcggacgcttccccaagtcttaaagtatcttcccgtcgaaaaggcacaa
gatgctcgcaactttatgctaagttttcagtattggttagggggatcggcggaaaattta
gagaatttcctgctaatgttggcgcacaagtattcctaccccgacttactccaagataag
accgttgactacaaagatcccgtcgtctaccccgatatgggaatatggcatcccctctcg
atgcaaatgttcgaggatgtcccttcctatttacaatggttcaacagtcggacggatatc
tccgataacctcaaagatcccttggccccctgtgttggtttaattttacaacgaacccat
cttgtaaccggagatgatgctcactatgtagccatggtacaagaattagagtgcatggga
gcaagggttattcccgtgtttgcagggggattagacttttctaaacccgtggaagcctat
ttctgggatcgcagcgtcaaagggatagaacctgtagctattgtagacaccgttgtatcc
ttaacagggtttgccttagtcggtggtcctgcgcgtcaagaccatcctaaagcgatagaa
tcattaaaacgcctcaaccgtccctatatgtgtgcgttacctctcgtcttccaaaccacc
caagaatgggaagcaagcgatttagggttacatccgatccaagttgccttacaaattgct
atccctgagttagacggtgctattgaacccattatactctcaggacgggatggtaatacg
ggacgagcgatcgcccttcaagatcgtatcgaagcggtggcacaacgggcattaaaatgg
gctaatctacggaaaaaacctaaattagacaagaaagtcgctattaccgtctttagcttc
cctcccgataaaggaaacgtgggaaccgcagcctatttagacgtatttggctctatttac
gaggtaatgaaggcattaaaaggcaatgggtacgatgtgcaagaattacccgactccccc
aaagctttgatggaagcagtgatccacgatgcacaagcgcagtatgcgtcccctgagttg
aatatagcctatcggatgtccgtggaacaatacgaacgcttaaccccctattcggttcgc
ttggaagaaaattggggtcctcctccgggtcatttaaacagtgacggacagaatttatta
atctatggcaaacagtttggtaacgtctttattggagttcaaccgacctttggttatgaa
ggtgatcccatgcgcttactattctcaagatcggccagtcctcatcatgggtttgctgcc
tattacacctatttaaaccaagtttggaaagccgatgcagtgttgcattttggaacccat
ggatcactggaatttatgccagggaaacagatgggaatgtcgggagaatgttaccctgat
agtttgattggaatgatccccaatttgtattattatgcggcgaataatcctagtgaagca
accattgctaaacgtcgcagctatgcggaaaccatctcctatttaacccctcctgcggag
aatgcagggttatacaaaggactgcaagaattaagtgaattaatagggtcataccaaacc
ctcaaagatagcggacggggtatccctattgttaacaccatcatggataaatctcgctta
gtcaatttggatcaggatattgcattacctgacaccgatgctaaagatatgacctccgaa
gaacgggataatattgtcggtttggtttaccgaaaattgatggaaattgagtcccgtttg
ttgccttgtggccttcatgttattggtaaacctccctccgcagaagaagcgatcgcaacg
ttagtcaatattgctgctttagaccgcgaagaagaaggaattacctccttaccccgtatt
attgctaacagtgtgggacgggaaattgaggaagtttatcaaaacagcgatcgcggtatt
ctagaagatgtggaattactgcaacaaattaccctagcaacccgtgaagcagtgtctgct
ttagtcaaagaacaaatagatgcagaaggacgagtttcctttgtttctaaactcaatttc
tttaacatgggtaaaaagacaccttgggtcgaaaccctccataatttagggtataaaaat
gtcgatcaagatgccttaaaacccctttttgaatacctagaattttgtttagaacaggtt
tgtgcggataacgaattaggagggttactaaaagcattagaaggggaatatgtgttaccc
ggacctggaggtgatcctatccgtaaccccaacgttttacccactggtaaaaacatccac
gcattagacccccaatctatccccaccttagccgccgttaagtccgctaaaattgtcgta
gatcgattattagcgcgtcaaaaaattgataacggaggcaattatcccgaaaccattgct
tgcgttttgtggggaacggataacatcaaaacctatggggagtccctcgcacaaatcatg
tggatggtaggagttaaacctgttcccgatgcgttaggacgagtcaacaaattagagtta
atttccctcgaagaattaggacgacctcgtattgatgtagtggtcaactgttcgggagtg
ttccgtgacctatttattaaccaaatgaacctcttagatcaagcggttaaaatggcagca
gaagcgaacgaacccctagaaatgaactatgtccgtaaacacgctttacagcaagctgag
gaaatgggaattaacctgcgtcaagcagcaacccgcatcttttctaacgcttctggttcc
tattcgtctaacgtcaatttagcggtagaaaatagcagttgggaagaagaaaaagagtta
caagatatgtatctcaaccgcaaagggtttgccttcgactctgataacccaggggtcatg
aatgacaaccgtaaagtgtttgaagctgcattaaaaacagccgatgcaaccttccaaaac
ttagattcttccgaaattagtttaacggatgtttcccattattttgactctgaccccaca
aaagttgtagctagtttacggggagatggtaaaaaaccagccgcgtatattgccgataca
actaccgcaaacgcacaggttcggacgctatcggaaactgtccgtttagatgcgcgtacc
aagttattaaaccctaaatggtacgagggaatgttatcccacggttacgaaggggtaaga
gaactttctaaacggttagtcaatacaatgggatggtctgcaactgctgatgcggtagat
aattgggtctatgaagacgtaaatacaacctttattcaagatgaggaaatgtgtaaacgt
ctgatgaatttaaaccccaattctttccggaaaatggtcggtactttattagaagttaat
ggccgtggttactgggaaacatcacaggaaaacttagacaagttacaggaattgtatcag
gaggttgaggacagaattgaaggagtagagtaa

DBGET integrated database retrieval system