KEGG   Cyanothece sp. PCC 7822: Cyan7822_0124Help
Entry
Cyan7822_0124     CDS       T01310                                 

Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_0124
   01230 Biosynthesis of amino acids
    Cyan7822_0124
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cyan7822_0124
   00040 Pentose and glucuronate interconversions
    Cyan7822_0124
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7822_0124
Enzymes [BR:cyj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Cyan7822_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(134971..135678)
Genome map
AA seq 235 aa AA seqDB search
MTQNGHSKSIVVAPSILSADFSRLGEEIQAIDKAGADWVHVDVMDGRFVPNITIGPLIVE
AIRPYTKKPLDVHLMIVEPEKYVADFAKAGADIISVHAEHNASPHLHRTLGQIRECGKQA
GVVLNPSTPLDFIEYVLELCDLVLIMSVNPGFGGQSFIPEVVPKIQKLRQMCDERGLDPW
IEVDGGLKPDNTWQVLEAGANAIVAGSAVFKASDYSKAIEGIRHSKRPQAQLASV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaacggacattccaaatccatagtcgttgcgccctccattttatcggctgac
tttagccgcctcggagaagaaatacaagccatagataaagccggcgcagactgggtacac
gtagacgtgatggatgggcgctttgttcccaacatcaccatcggtccactgatcgtagaa
gctattcgtccttataccaaaaagcctctagacgttcacttaatgatcgtcgaacccgaa
aaatatgtcgctgactttgctaaagccggcgctgatattatttcagttcatgcggaacat
aacgcttcaccccacttacaccgtactctcggccaaattcgggaatgcggaaaacaggcg
ggtgtagttcttaacccctctacccctttagactttatagaatatgttttagagttatgc
gatttagtattaattatgagcgttaaccccggttttgggggccaaagctttattcctgaa
gttgtacctaaaattcaaaaattgcgtcaaatgtgtgatgaacggggattagatccttgg
attgaagttgatggcggattaaaaccggataacacttggcaagttttagaagcgggtgct
aatgcgatcgtagcgggttcggctgtatttaaggcttctgattattctaaagccattgaa
ggcatccgccacagcaagcgtcctcaagctcaattagctagtgtttaa

DBGET integrated database retrieval system