KEGG   Cyanothece sp. PCC 7822: Cyan7822_0124Help
Entry
Cyan7822_0124     CDS       T01310                                 

Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00030  Pentose phosphate pathway
cyj00040  Pentose and glucuronate interconversions
cyj00710  Carbon fixation in photosynthetic organisms
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01120  Microbial metabolism in diverse environments
cyj01130  Biosynthesis of antibiotics
cyj01200  Carbon metabolism
cyj01230  Biosynthesis of amino acids
Module
cyj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cyj_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cyan7822_0124
   00040 Pentose and glucuronate interconversions
    Cyan7822_0124
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7822_0124
Enzymes [BR:cyj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Cyan7822_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim His_biosynth ThiG NanE
Motif
Other DBs
NCBI-ProteinID: ADN12175
JGI: Cyan7822_0124
UniProt: E0UII1
Position
complement(134971..135678)
Genome map
AA seq 235 aa AA seqDB search
MTQNGHSKSIVVAPSILSADFSRLGEEIQAIDKAGADWVHVDVMDGRFVPNITIGPLIVE
AIRPYTKKPLDVHLMIVEPEKYVADFAKAGADIISVHAEHNASPHLHRTLGQIRECGKQA
GVVLNPSTPLDFIEYVLELCDLVLIMSVNPGFGGQSFIPEVVPKIQKLRQMCDERGLDPW
IEVDGGLKPDNTWQVLEAGANAIVAGSAVFKASDYSKAIEGIRHSKRPQAQLASV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaacggacattccaaatccatagtcgttgcgccctccattttatcggctgac
tttagccgcctcggagaagaaatacaagccatagataaagccggcgcagactgggtacac
gtagacgtgatggatgggcgctttgttcccaacatcaccatcggtccactgatcgtagaa
gctattcgtccttataccaaaaagcctctagacgttcacttaatgatcgtcgaacccgaa
aaatatgtcgctgactttgctaaagccggcgctgatattatttcagttcatgcggaacat
aacgcttcaccccacttacaccgtactctcggccaaattcgggaatgcggaaaacaggcg
ggtgtagttcttaacccctctacccctttagactttatagaatatgttttagagttatgc
gatttagtattaattatgagcgttaaccccggttttgggggccaaagctttattcctgaa
gttgtacctaaaattcaaaaattgcgtcaaatgtgtgatgaacggggattagatccttgg
attgaagttgatggcggattaaaaccggataacacttggcaagttttagaagcgggtgct
aatgcgatcgtagcgggttcggctgtatttaaggcttctgattattctaaagccattgaa
ggcatccgccacagcaagcgtcctcaagctcaattagctagtgtttaa

DBGET integrated database retrieval system