KEGG   Cyanothece sp. PCC 7822: Cyan7822_0159Help
Entry
Cyan7822_0159     CDS       T01310                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_0159
   01230 Biosynthesis of amino acids
    Cyan7822_0159
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_0159
   00030 Pentose phosphate pathway
    Cyan7822_0159
   00051 Fructose and mannose metabolism
    Cyan7822_0159
   00052 Galactose metabolism
    Cyan7822_0159
  Energy metabolism
   00680 Methane metabolism
    Cyan7822_0159
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cyan7822_0159
Protein phosphatases and associated proteins [BR:cyj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cyan7822_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
178286..179368
Genome map
AA seq 360 aa AA seqDB search
MGATKRIGILTSGGDCAGLNPVIRAVVHHANGNYGWDVLGICQATNGLMSRPPQAIHLDL
NEVDRLLTLGGTMLGTTNKGDPFAFPMGDGTVLDRSNEIIEGYHSLGLDALIGIGGDGSL
AILRRLAQQGGMNLVGIPKTIDNDVGLTERSIGFDTAVNIATEALDRLHFTAASHNRVLI
LEVMGRDAGHIALNAGIAGGADIILIPEIPYKLENVCAQIKKRQDRGKHFCLVMVSEAVC
TEGGEQVTQMQQFGECRFGGIGQYIASQIAEYTGAETRVTVLGHLQRGGIPSPGDRLLAS
AFGVAAVDLIAQEKFDQMVTWQKRQVVSVPIAEAIQNYRNVDPQGTMVKTARGLGICLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctaccaaaagaattggaattctcaccagtgggggtgactgtgctggtttaaat
cctgtcattcgtgctgttgtgcatcatgctaatggtaattatggttgggatgtcttagga
atttgtcaagcaaccaacgggttgatgagtcgtcctccccaagcgattcatctagacttg
aatgaggttgatcgccttttaacccttggaggaacgatgttagggacaaccaacaaaggt
gatccctttgctttcccgatgggtgatggaaccgtcctagaccgctccaatgaaattata
gaagggtatcatagtttaggattagatgccctaataggcattgggggtgatggaagttta
gccattttgcggcgcttggcccaacaaggcggcatgaatctagtgggtattcccaaaacc
attgataatgatgtgggactaacagaacgttctatcgggtttgatactgccgttaatatc
gccacagaagccttagatcgacttcattttaccgcagccagtcataatcgagtgctgatt
ttagaagtcatggggcgtgatgctggacatattgcgcttaatgccggtattgctggcgga
gcagatattattttaataccagaaattccctataaattagaaaatgtttgtgcccaaatt
aagaaacgtcaagatagaggcaaacatttctgtttagtcatggtgtcagaagccgtttgt
actgaagggggagaacaagtcacccagatgcaacaatttggcgaatgtcgtttcggcggt
attggtcaatatattgccagtcaaattgctgagtatacaggggcagaaacccgagtaacc
gtattaggacacctacaacgaggggggataccttcgccaggcgatcgcctattagcctca
gcttttggagtagcggcagtggatttaattgctcaagaaaaatttgatcagatggtcact
tggcaaaagcgtcaagtggttagtgttcctattgctgaagcgattcaaaattatagaaat
gttgatccccaaggaacaatggtcaaaactgccagaggtttaggaatttgtctaggagat
tag

DBGET integrated database retrieval system