KEGG   Cyanothece sp. PCC 7822: Cyan7822_0201Help
Entry
Cyan7822_0201     CDS       T01310                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00860  Porphyrin and chlorophyll metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan7822_0201
Enzymes [BR:cyj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cyan7822_0201
Exosome [BR:cyj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan7822_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADN12251
JGI: Cyan7822_0201
UniProt: E0UJK7
Position
223953..224942
Genome map
AA seq 329 aa AA seqDB search
MFPITRPRRLRQTSQLRRMVRETVLTTNDLIYPLFAVPGEGVATEVKSMPGVFQLSVDKI
VEDAKEVYDLGIPSIILFGIPDTKDTDATGAWHDCGIVQKAATAVKEAVPDLIVIADTCL
CEYTSHGHCGYLEVGDLTGRVLNDPTLELLKKTAVSQAKAGADIIAPSGMMDGFVSAIRQ
GLDEAGFEDTPILSYAAKYASAYYGPFRDAAESSPQFGDRRTYQMDPGNAREALKEVQLD
VEEGADMLMVKPALSYMDIIWRVKEITDLPVAAYNVSGEYAMIKAAALNGWIDEKRVTLE
TLTSFKRAGADLILTYHAKDAARWLQEQD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccattactcgccctcgccgcttgcgtcaaacctctcaactgcgccgtatggtg
cgggaaacggttttaacgacgaatgatttaatttatcctttgtttgccgtacccggagag
ggagtcgctacagaagtaaaatcaatgcccggagtgtttcaactctcggtggataaaatt
gtagaagacgcgaaagaagtttatgacttagggataccttctattattctttttggtatt
cctgacacgaaagatactgatgcaaccggtgcctggcacgactgcggcattgtacaaaag
gcagccaccgccgtaaaagaggctgtcccggatttaattgtgattgctgatacctgtctg
tgtgaatataccagtcatggtcactgtggttatttagaagtaggagacttaaccgggcgg
gtactcaatgaccctaccctagagttactcaaaaaaaccgccgtctctcaagctaaagcc
ggggctgatattattgcgccttcgggaatgatggatggttttgtgagtgctattcgtcaa
ggtttagatgaggcgggttttgaagatactccgattctttcctatgcggctaaatatgcc
tctgcctattatggacccttccgagatgcggctgagtcttcccctcaatttggtgaccgc
cgcacctaccaaatggaccccggcaatgccagagaggccctcaaagaggtacagttagac
gtggaagaaggggcggatatgttgatggttaaaccggccttgtcttatatggatattatc
tggcgggtgaaagaaattactgatttacccgttgccgcttacaacgtctctggagaatat
gccatgattaaagcggctgccctgaatggctggattgatgaaaaacgggttactttagaa
accttaaccagtttcaaacgagccggggctgatttaatcttgacttatcatgccaaagat
gcggctcgctggctacaagagcaagattaa

DBGET integrated database retrieval system