KEGG   Cyanothece sp. PCC 7822: Cyan7822_0523Help
Entry
Cyan7822_0523     CDS       T01310                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cyan7822_0523
Enzymes [BR:cyj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cyan7822_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
581749..583977
Genome map
AA seq 742 aa AA seqDB search
MNLQDSSVPYRCQAPESLTGVVERITYHAEESGYTVARLQSPRAKELVTVVGNFANIQAG
QTLQLKGVWKNHPQYGQQFEVQQYTETKPATLTGMEKYLGSGLIKGVGPVTAKRIVAHFG
LETLEIIENKTQRLIEVPGIGKKRVVMIQKAWETQKAIKEVMVFLQGHGVSTTYAVKIFK
QYGANAIATVTDNPYQLADDIYGIGFLTADKIAYNVGVSPWSKYRYKSGILHVLSQAAED
GHCFLPQPELMKLSAELLSNGEHEAEIESISAIIDEMGQQQALMVEKGEGGMPLCYKPAF
FYTEENLAQLLRQQLSHPVEVDLPRVRNWIERFTQSRGISLSPQQLEAVEMAASSRVMVL
TGGPGTGKTFCTRTIVALWKAMGKKIGLAAPTGRAAQRMGEVTGLEAKTLHRMLEFDPAT
MGFKRDKDNPLPYDAIVVDETSMLDLFLAHSLLKAIPPQACLLLVGDVDQLPSVGPGKIL
ADLIDSVKIPIVRLSQIFRQASSSAIIRAAHQINGGQYPKLEPISDAPQSDCLWHNGGTE
PEHGVMVVCELIRDFIPRQGFNPVTDVQVLCPMTRGAVGTRNFNQVLQQLINPPSPDKPE
VSRGGMTFRVGDRVIQLKNDYEREVFNGDLGMVAAIDPVEQELTICFDGREVVYDFADLN
EVALAWSISIHKSQGSEYPVVLLPIYTSHYIMLSRNLIYTGLTRAKKLAIVIGSSKAIGM
AVRQVNQQERYTRLKERLTGLK
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccaagactcctcagtaccctaccgatgtcaagcacctgaatctctcaccggc
gtggtagaacgcattacctaccacgccgaagaatcgggttataccgtcgctcggctacaa
tcccccagagcaaaggaattggtgacggtagtgggcaacttcgctaatattcaagccggg
caaaccctccagcttaaaggagtgtggaagaatcacccccaatacggtcagcagttcgag
gttcagcagtacactgaaacgaaacccgctaccctcacaggtatggagaaatatttggga
agcggcttaattaaaggagtcggccccgttaccgctaaacggattgtggcacactttggt
ttagaaactttagaaatcatcgaaaacaagactcaaaggctgatagaagtcccaggcatc
ggcaaaaagcgggttgttatgattcaaaaagcctgggaaactcagaaagccatcaaagaa
gttatggttttcttgcaggggcatggagtttctaccacttacgctgtcaagatttttaag
cagtatggagcaaatgcgatcgctactgtcacagacaacccttaccaactagcagatgat
atttatgggatcggtttcctgaccgccgataaaattgcttataacgtgggtgtttctccc
tggtcgaagtatcgttataagtcgggaatcttgcacgttttaagccaagctgccgaggac
ggacactgttttttacctcaacccgaattgatgaagctatcagcagaactcctcagcaac
ggagaacatgaagccgaaatagaatcgattagtgccattattgacgagatgggacaacag
caagccttgatggtagaaaaaggagaaggagggatgcctctgtgctacaaaccggctttc
ttttacactgaggaaaatctcgctcaattactacgacaacaactttcacacccggttgaa
gttgatttgccccgtgtcaggaattggatagaacgttttactcaaagtagaggaatttct
ctttctccccaacagcttgaagcggtagagatggcggcttcctcacgggtaatggttctt
acggggggtccagggacgggaaaaaccttctgtacccgtactattgtggctttatggaaa
gcgatgggtaagaagattgggttagccgctcctactggacgagcagcacagagaatgggg
gaggtaacgggtttagaagctaagactctccacagaatgctcgaatttgaccccgctact
atggggtttaaacgggataaggacaatcccctgccctacgatgctatcgtagtggatgaa
acttcaatgctggatttgtttctggctcattcgttgttaaaagcgatcccaccacaagct
tgcttgttgttagtaggggacgtggatcagttgcccagtgtgggacctggaaaaatctta
gctgacttaattgattcggtgaaaattcccatcgtgcgtttatcccaaattttccgtcaa
gcatcttcgagtgctattatccgcgctgcacatcaaattaatggaggacaatatcccaaa
ttagaaccaattagcgatgctccgcaatcagattgtctttggcataatggtggaactgag
ccagaacatggggtaatggtggtttgtgaactcatccgtgattttattccccgtcaaggt
ttcaatcctgtaactgacgtacaggtactttgtccgatgacgagaggtgcagtggggacg
cgcaattttaaccaagttcttcagcaattaatcaacccccctagtcccgataaacccgaa
gtttccagaggggggatgactttccgagtgggagatagagtgattcaactgaagaatgat
tatgagagagaagtgtttaatggggatttaggaatggtagcggctattgatccagttgaa
caagaactaactatctgctttgacggacgagaagtggtttatgattttgccgacctcaat
gaagtagctttggcttggtcgatttccatccataaaagccaagggtcagagtatccagtg
gttttactgccgatttacaccagtcattatataatgctctctcgaaatcttatttacaca
gggctgactcgtgctaagaaattggctattgtcattgggtcttctaaggccatagggatg
gcggtgaggcaagtgaaccaacaagagcgttatacaaggttgaaggaacgcctgacgggg
ttaaaatga

DBGET integrated database retrieval system