KEGG   Cyanothece sp. PCC 7822: Cyan7822_0578Help
Entry
Cyan7822_0578     CDS       T01310                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00860  Porphyrin and chlorophyll metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan7822_0578
Enzymes [BR:cyj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan7822_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA DUF815 ABC_tran AAA_18 AAA_7 AAA_30 MMR_HSR1 RNA_helicase tRNA_lig_kinase AAA_27 AAA_28 AAA_14
Motif
Other DBs
NCBI-ProteinID: ADN12615
JGI: Cyan7822_0578
UniProt: E0U9C3
Position
complement(638583..639656)
Genome map
AA seq 357 aa AA seqDB search
MTATLQAPRSTRRVVFPFTAIVGQEEMKLALLLNVIDPKVGGVMIMGDRGTGKSTTIRAL
ADLLPEIEIVANDPFNSHPEDPDLMSDQVRQQLEEQIPLTTAKKKVSMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDQDP
LAFCGKYQAEQDLLQQKLVNAQQLLSRVNIDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALTAFEGRTEVTVDDIKRVITLCLRHRLRKDPLESIDSGYKVQKAFSRVFGLDVAE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgactgccactctccaagctcctcgctcaacccgccgagtcgtctttccttttactgct
attgtgggccaagaagaaatgaaactggccttactccttaacgtaattgatcccaaagtt
ggtggtgtgatgattatgggggatcgcggaaccggtaaatcgactactatccgtgcttta
gcggatttattgccagaaatagagatagtagctaacgatccctttaattcccatcccgaa
gacccggacttgatgagtgatcaagtcagacagcaactagaagaacaaattcccttaacc
accgccaagaaaaaagtctcgatggtagacttacccttgggagctacagaagaccgagtt
tgcggcacgatcgatatagaaaaagccctatcagaaggggtcaaagcttttgaacctgga
cttttagccaaagctaaccgaggtatcctctatgtagatgaggtgaacttattagacgat
cacttagtggatgtgttgctcgactctgccgctagtggatggaatacggtagaacgcgaa
gggatttctatccgtcatccggcccgctttgttctggtgggttcaggaaaccccgaagag
ggagaattacgacctcaattattagaccgtttcggaatgcacgccgaaattcacaccgtt
aaagagccgccgctacgagtgaaaattgtagagcaacgggcagaatttgaccaagatccc
ttagctttctgtggaaaatatcaagctgaacaagaccttttacagcaaaagttggtcaat
gctcaacaacttttatcccgagttaatattgattatgatttacgggtgaaaatttccgaa
gtctgttcagaattagatgtcgatggtttgcgaggtgatattgttaccaatagagcggct
aaagctttaaccgcttttgaaggacgcacagaagtaaccgtcgatgatattaagcgagtt
attactctgtgtctgcgccatcgtctccgtaaagatcccctagaatctattgattctggt
tataaggtacaaaaagcctttagccgcgtttttggcttagatgtagcagaataa

DBGET integrated database retrieval system