KEGG   Cyanothece sp. PCC 7822: Cyan7822_0696Help
Entry
Cyan7822_0696     CDS       T01310                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00900  Terpenoid backbone biosynthesis
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01130  Biosynthesis of antibiotics
Module
cyj_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cyan7822_0696
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cyan7822_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N CMD Stomagen
Motif
Other DBs
NCBI-ProteinID: ADN12728
JGI: Cyan7822_0696
UniProt: E0UAI7
Position
760127..761077
Genome map
AA seq 316 aa AA seqDB search
MHAYTLIAPGKINLYLEIIGDRPDGYHELIMILQSIDLADRLTLRSNGLQKCRLSCSHPQ
VPLDETNLAYRAAVLMEQEFPKEFANYGGVDITIDKQIPVAAGLAGGSTDGAAVLVGLNL
IWQLGLTQLELQNLAALLGSDLPFCVSGGTAIATGRGEKLDQINNLANLYLVLAKYDSIA
VSTPWAYQTYRQQFSDSYINHLSGIEAKTHQVHAGPLVGAIVHKDGAKIGQLLHNDLEKV
VLPAYPQVAQLRETMQQAGGLGTMMSGSGPTVFTLCESREQAAEIQQKIRQKLPDSDLQL
WVAQLSNRGIQVETAS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttatactttaattgcccctgggaaaattaatctgtatttagaaattatcggc
gatcgcccggatggctatcatgaactgatcatgatcctccaaagcattgacttagcggac
cgcctgactctacgttctaacgggttgcaaaagtgccgcctttcttgttctcatccccaa
gtccccctagatgaaactaacttggcctatcgagcggctgtcttaatggagcaagaattt
cccaaagaatttgctaactatgggggagtagatattaccattgacaaacagatcccagta
gcggccggattagctggcggctctacagatggggcggcggtattagtgggattaaattta
atctggcaactcggactcactcaactggaattacaaaatttagccgcactattagggtct
gatttgcctttctgcgtgtcagggggaacagctatagcgacaggaagaggagaaaaactc
gatcaaatcaataatttagctaatctttaccttgttttagctaaatatgatagtattgcc
gtatctaccccttgggcttaccaaacttatcggcaacagtttagtgatagctacattaat
catctgtcaggaattgaagccaaaactcatcaagttcatgccggtccattagtgggtgca
attgtacataaagatggagcaaaaatcggccaattattgcacaatgacctagaaaaagtc
gttttacccgcctatccccaagtagctcaacttcgagaaaccatgcagcaggctggcggt
ctaggaaccatgatgtccgggtcgggtccgacggtgtttaccctgtgtgagtcaagagaa
caagcagcagaaattcaacaaaaaataagacagaaactccccgattcagatttacaatta
tgggtagctcaattgtcaaatcggggaattcaagtagaaactgctagttaa

DBGET integrated database retrieval system