KEGG   Cyanothece sp. PCC 7822: Cyan7822_0696Help
Entry
Cyan7822_0696     CDS       T01310                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cyj00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
760127..761077
Genome map
AA seq 316 aa AA seqDB search
MHAYTLIAPGKINLYLEIIGDRPDGYHELIMILQSIDLADRLTLRSNGLQKCRLSCSHPQ
VPLDETNLAYRAAVLMEQEFPKEFANYGGVDITIDKQIPVAAGLAGGSTDGAAVLVGLNL
IWQLGLTQLELQNLAALLGSDLPFCVSGGTAIATGRGEKLDQINNLANLYLVLAKYDSIA
VSTPWAYQTYRQQFSDSYINHLSGIEAKTHQVHAGPLVGAIVHKDGAKIGQLLHNDLEKV
VLPAYPQVAQLRETMQQAGGLGTMMSGSGPTVFTLCESREQAAEIQQKIRQKLPDSDLQL
WVAQLSNRGIQVETAS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttatactttaattgcccctgggaaaattaatctgtatttagaaattatcggc
gatcgcccggatggctatcatgaactgatcatgatcctccaaagcattgacttagcggac
cgcctgactctacgttctaacgggttgcaaaagtgccgcctttcttgttctcatccccaa
gtccccctagatgaaactaacttggcctatcgagcggctgtcttaatggagcaagaattt
cccaaagaatttgctaactatgggggagtagatattaccattgacaaacagatcccagta
gcggccggattagctggcggctctacagatggggcggcggtattagtgggattaaattta
atctggcaactcggactcactcaactggaattacaaaatttagccgcactattagggtct
gatttgcctttctgcgtgtcagggggaacagctatagcgacaggaagaggagaaaaactc
gatcaaatcaataatttagctaatctttaccttgttttagctaaatatgatagtattgcc
gtatctaccccttgggcttaccaaacttatcggcaacagtttagtgatagctacattaat
catctgtcaggaattgaagccaaaactcatcaagttcatgccggtccattagtgggtgca
attgtacataaagatggagcaaaaatcggccaattattgcacaatgacctagaaaaagtc
gttttacccgcctatccccaagtagctcaacttcgagaaaccatgcagcaggctggcggt
ctaggaaccatgatgtccgggtcgggtccgacggtgtttaccctgtgtgagtcaagagaa
caagcagcagaaattcaacaaaaaataagacagaaactccccgattcagatttacaatta
tgggtagctcaattgtcaaatcggggaattcaagtagaaactgctagttaa

DBGET integrated database retrieval system