KEGG   Cyanothece sp. PCC 7822: Cyan7822_0796Help
Entry
Cyan7822_0796     CDS       T01310                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00300  Lysine biosynthesis
cyj00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cyan7822_0796
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cyan7822_0796
Enzymes [BR:cyj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Cyan7822_0796
Peptidoglycan biosynthesis and degradation proteins [BR:cyj01011]
 Precursor biosynthesis
  Amino acid ligase
   Cyan7822_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF1028 SRP54
Motif
Other DBs
NCBI-ProteinID: ADN12822
JGI: Cyan7822_0796
UniProt: E0UBJ0
Position
complement(858697..860187)
Genome map
AA seq 496 aa AA seqDB search
MKLRELLTLIPTITQIPEHPALEKEVKGISTNSHACQLGDVFIGMPGTRVDGGEFWSSAI
EAGAIAAIISPAAALQYPPTGDAYVIQVEDVVSVCAEIAAAFYGYPARQMKMIGVTGTNG
KTTTTHLIEFFLSQCQYPTALLGTLYTRWAGYEQTAVHTTPFAAQLQEQLAQALKAGSQY
GVMEVSSHALAQRRVQECPFEVAVFTNLTQDHLDFHQDMEDYFAAKAKLFSAEYLKGKAI
INLDDPYGKRLIDSLSREKVWSYSVSDSSANFYTRDLCYEANGVSGILHTPIGEVAFYSP
LVGQYNIANLLAAVGAVVSLGLDLKAIVQYLPLFVAVPGRMERVHLSDKQDISVIVDYAH
TPDSLENLLKAARPFIEGRMICVFGCGGDRDRTKRPKMGKIAAELADVAVVTSDNPRTED
PQQILKDILAGIPESVKPQVIADRALAILKAITEAKPGDGVLIAGKGHEDYQILGTEKIH
FDDREQAREALTVRLG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagagaattattaaccctcattcccacgatcacacaaattcccgaacatcct
gccttagaaaaagaagttaaaggaatttctaccaactcccacgcctgtcaactcggagac
gtatttatcggtatgccaggcactagagtagatgggggagaattttggtccagtgcgatc
gaagccggtgcgatcgctgcaatcatttctcctgctgccgcccttcaatatcccccaacg
ggtgatgcttacgtgatccaagtggaagatgtcgtcagtgtttgtgcagaaatagcggcg
gctttttatggttatccagcgcgacagatgaaaatgatcggggtaaccggcaccaatgga
aaaaccaccactacccatttaattgaatttttcttgtctcaatgtcaatatcccactgcc
cttttaggcactttatatacccgttgggcgggatatgaacaaacggctgtacatactacc
ccttttgccgcacaattacaagaacaactcgcgcaagcgctaaaagccggcagtcagtat
ggggtgatggaagtgtcttctcatgctttggcgcaaagacgggtacaagaatgccctttt
gaggtggcagtatttactaacttgactcaagatcatctagactttcatcaggatatggag
gattattttgccgctaaagctaagttatttagtgcagaatatctcaagggtaaagccatt
attaacttagatgatccttatggaaagcgtttgatcgactccctcagtcgggaaaaagtt
tggagttatagtgttagtgatagttcggcgaatttttatactcgagatttatgctatgaa
gccaatggtgtgagtggaatcttacatactcccatcggtgaggtagctttttattctcct
ttagtggggcagtacaatattgctaacctcttagcggcggttggggcagtggtgtcttta
ggattagatttaaaggcgattgtgcaatatttacctttatttgtggcggtgccgggacgc
atggagagggtacatttgagtgataaacaggatattagtgttattgtggattatgctcac
acgcctgatagtttggagaatttattaaaggcagcccggccttttattgaaggtcggatg
atctgtgtgtttggatgcggcggagatagggaccgcactaaacgccctaagatggggaaa
atagcggctgaacttgccgatgtggcggtggtgacttcggataatcctcgcaccgaagat
ccgcagcagattttaaaggatattttggcgggaattcctgagtcggttaagccgcaagtc
attgctgatcgcgctttagctatcctcaaggcgatcaccgaagctaaacccggggatggg
gttttaattgctggaaaaggtcatgaggattatcaaattttgggcacagagaagatccat
tttgatgatcgagaacaagcgagggaagctttaacggttagattaggttga

DBGET integrated database retrieval system