KEGG   Cyanothece sp. PCC 7822: Cyan7822_1062Help
Entry
Cyan7822_1062     CDS       T01310                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00040  Pentose and glucuronate interconversions
cyj00052  Galactose metabolism
cyj00500  Starch and sucrose metabolism
cyj00520  Amino sugar and nucleotide sugar metabolism
cyj01100  Metabolic pathways
cyj01130  Biosynthesis of antibiotics
Module
cyj_M00362  Nucleotide sugar biosynthesis, prokaryotes
cyj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cyan7822_1062
   00052 Galactose metabolism
    Cyan7822_1062
   00500 Starch and sucrose metabolism
    Cyan7822_1062
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan7822_1062
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cyan7822_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 FUN14
Motif
Other DBs
NCBI-ProteinID: ADN13071
JGI: Cyan7822_1062
UniProt: E0UEU1
Position
1150875..1151762
Genome map
AA seq 295 aa AA seqDB search
MSKTVVKKGIIPAAGWGTRLFPATKVLKKEFFPIIDQDGRAKPIILAIVEELLSAGLEEI
AIIIQKSAQPLFENFFKTLPQPELYAKLSPENRDYCDYLQEIGKKITFIIQEQQEGYGHA
VYCAKDWINNQPFLLSLGDHVYRSETEISCSKQLVELYQKVEKNVVGLTVISAEILHKSG
VVSGNWQEKNSVLTIKKTWEKPTREEARSQLHIETLPENQFLALFGLYILSPKIFDYLGQ
EIQNNCRYRGEFQLTTALDQLCQNDGLIGYVVRGNYFDTGMPEFYRKTLIEFSKF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaactgtggtaaaaaaaggaattattccagcagccggatggggaactcgtcta
tttcctgccactaaagtcttaaaaaaagaattttttcccattattgatcaagatggtcga
gccaagccgatcattttagcaattgttgaagaattattgagtgcgggtttagaagaaatc
gcaattattattcaaaaaagcgctcaacccctgtttgaaaacttttttaaaactttaccc
caaccagaattatacgccaaactctcgcccgaaaaccgcgattactgcgactatttacaa
gaaataggcaaaaaaattactttcattattcaagaacaacaggaaggctacggacatgcc
gtttattgtgccaaagactggatcaataaccagccatttttactatcattaggagatcat
gtctatcgttcagagacagaaatctcttgtagtaaacagttagtagaactttatcaaaaa
gtcgaaaaaaatgtagtaggtttaaccgtcatatctgccgaaattctgcataaatctgga
gtcgttagcggaaattggcaagaaaaaaattcagttcttactatcaaaaaaacctgggaa
aaacccacccgagaagaagcccgttcacagttacatatagaaaccctgccagaaaatcaa
tttttggctctatttggattatatatattaagcccaaaaatctttgattacttaggccaa
gagattcaaaacaattgccgttatcgaggagaatttcaactaacaaccgctttagatcag
ctatgtcaaaatgacgggctgatcggttatgttgttcggggtaactactttgatacagga
atgccggaattttaccgaaaaactttaattgaatttagcaaattttaa

DBGET integrated database retrieval system