KEGG   Cyanothece sp. PCC 7822: Cyan7822_1062Help
Entry
Cyan7822_1062     CDS       T01310                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cyan7822_1062
   00052 Galactose metabolism
    Cyan7822_1062
   00500 Starch and sucrose metabolism
    Cyan7822_1062
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan7822_1062
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cyan7822_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1150875..1151762
Genome map
AA seq 295 aa AA seqDB search
MSKTVVKKGIIPAAGWGTRLFPATKVLKKEFFPIIDQDGRAKPIILAIVEELLSAGLEEI
AIIIQKSAQPLFENFFKTLPQPELYAKLSPENRDYCDYLQEIGKKITFIIQEQQEGYGHA
VYCAKDWINNQPFLLSLGDHVYRSETEISCSKQLVELYQKVEKNVVGLTVISAEILHKSG
VVSGNWQEKNSVLTIKKTWEKPTREEARSQLHIETLPENQFLALFGLYILSPKIFDYLGQ
EIQNNCRYRGEFQLTTALDQLCQNDGLIGYVVRGNYFDTGMPEFYRKTLIEFSKF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaactgtggtaaaaaaaggaattattccagcagccggatggggaactcgtcta
tttcctgccactaaagtcttaaaaaaagaattttttcccattattgatcaagatggtcga
gccaagccgatcattttagcaattgttgaagaattattgagtgcgggtttagaagaaatc
gcaattattattcaaaaaagcgctcaacccctgtttgaaaacttttttaaaactttaccc
caaccagaattatacgccaaactctcgcccgaaaaccgcgattactgcgactatttacaa
gaaataggcaaaaaaattactttcattattcaagaacaacaggaaggctacggacatgcc
gtttattgtgccaaagactggatcaataaccagccatttttactatcattaggagatcat
gtctatcgttcagagacagaaatctcttgtagtaaacagttagtagaactttatcaaaaa
gtcgaaaaaaatgtagtaggtttaaccgtcatatctgccgaaattctgcataaatctgga
gtcgttagcggaaattggcaagaaaaaaattcagttcttactatcaaaaaaacctgggaa
aaacccacccgagaagaagcccgttcacagttacatatagaaaccctgccagaaaatcaa
tttttggctctatttggattatatatattaagcccaaaaatctttgattacttaggccaa
gagattcaaaacaattgccgttatcgaggagaatttcaactaacaaccgctttagatcag
ctatgtcaaaatgacgggctgatcggttatgttgttcggggtaactactttgatacagga
atgccggaattttaccgaaaaactttaattgaatttagcaaattttaa

DBGET integrated database retrieval system