KEGG   Cyanothece sp. PCC 7822: Cyan7822_1094Help
Entry
Cyan7822_1094     CDS       T01310                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cyj00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cyj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1188043..1189353)
Genome map
AA seq 436 aa AA seqDB search
MKETYITTNSQALTESDSPVLEIWGPTSLKGEVRISGAKNSALAIMAGTLLCSDDCRISN
VPSLMDVGRMVQILAALGVKINRKQDTLEINATEIGQTQAPYDLVSQLRASFFVIGPLLA
RLGVARVPLPGGCAIGARPVDLHVRGLQAMGAEVTIEHGIVHAYVKGSSRRLKGASIYLD
YPSVGATETIMMAATLAEGETTIGNAAQEPEVEDLANFCRSMGAKIRGAGTNTIIVSGVE
RLHSTDYPIIPDRIEAGTFLVAGAITHSPISLYPVIPEHLSPVIAKLKEVGCNVILEDYK
RLRLVPGELRATDIETLPYPGFPTDMQAQFMALLTKSEGNSMVTETVFENRLRHVAELQR
MGADIKVKGNVAVVKGVPFLSGAPVMATDLRASAALVLAGLAARGKTVVQGLHHLDRGYE
NIEDKLRQLGANLQRV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ataaaagagacttatattaccaccaactctcaagccctaacggaatctgatagcccggtt
ttagaaatctggggtccgacttctttaaaaggagaagtaaggatcagtggggcaaaaaat
tctgctttagccattatggcgggaactttgttgtgttcggatgattgccgcattagcaac
gttccctctctgatggatgtagggcggatggtgcaaattttggcggctttgggggtaaaa
attaacaggaagcaagacaccctcgaaatcaatgctaccgaaattgggcaaacccaagcg
ccttatgacctagtttctcagttaagagcgagtttctttgtgattggtccattgctggcg
agattaggggttgctagagtgcctttaccgggcggctgtgctattggtgctaggccggta
gatcttcatgtgcgcggactccaagcgatgggagcagaggtaaccatcgaacatggaatt
gttcatgcttatgtgaagggaagtagccgccgcctaaaaggagctagtatttacctagat
tatcctagtgtaggggccacagaaacgattatgatggcggcgaccctagccgaaggagaa
accaccatcggcaatgcggcacaagaaccggaagtagaagatttagcgaatttctgccgc
tcaatgggggcgaaaattcggggagcagggacgaatactattattgtctctggggttgag
cgtttacatagcacagattacccgattatccctgatcgtatcgaagccggcacgtttttg
gtagcgggtgccattacccactctcctattagtctatatccggtgattcctgaacattta
agtcctgtgattgccaaattgaaagaagttggttgtaacgtaattcttgaggattataag
cggctgcggctggttcctggggaattgcgggcaacagatattgaaaccctaccctatcct
ggttttcccaccgatatgcaagctcagtttatggcgttacttaccaagagtgagggcaat
agtatggtgacagaaacggtattcgagaaccgtttacgccatgtggctgagttacaacgc
atgggcgctgatattaaagttaaaggaaatgtcgcagtagtcaagggcgttcctttcctc
tcgggtgcgccggtgatggcgactgatttgagagcttctgccgccttggttttggcaggg
ttagcggcgagaggtaaaaccgttgttcaaggattgcatcatttagatcggggttatgaa
aatatagaggataaactccgacaattaggcgctaatttacaacgggtttag

DBGET integrated database retrieval system