KEGG   Cyanothece sp. PCC 7822: Cyan7822_1182Help
Entry
Cyan7822_1182     CDS       T01310                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan7822_1182
Enzymes [BR:cyj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cyan7822_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1294990..1296495
Genome map
AA seq 501 aa AA seqDB search
MPFPRSSGILLHPTSFPSRYGIGDLGIEAYHFIDFLVRSGQRYWQMLPLNPPSVGNSPYM
SFSAMAGNPLLISPDLLLEKGLLNPEDLQDLPEFPLDYVDFEQVIAWKMPILRKAAQNFA
HKAPPVMRRRFDGFCQGKAHWLEDYALFMALLESQDQPVWTEWPSELRHRHWDALEYARE
QLKEEIFFHKFLQFEFIEQWLELRGYTNTLNIQIIGDIPIYVGHNSADVWANPQVFKLDP
ETGNPLEVAGVPPDYFSATGQLWGNPLYNWEHLQHTGFDWWVRRVREVLTHVDLIRIDHF
RGLESYWSVPAGETTAINGRWLKAPGYAFFDTIRAKLGKLPIIAEDLGDIDQAVLDLRDH
YEFPGMKILQFAFGGGSDNPYLPFNVERNSIIYTGTHDNNTSNGWYYDNANDHEKGRLYQ
YMGCTGEYSIAWDLIRLAYSSVANQAIIPLQDVFSLGSDARMNTPGLSDGNWGWRYRNEA
LIEEYIHRLRDMVHLYGRYPG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccctttccgcgctccagtggcattttacttcatcccaccagctttcctagtcgctac
ggtatcggagatctcggtatagaagcctatcattttatcgattttttagtccgtagtggg
caacgctactggcaaatgttgccgctaaatcctcctagcgtgggcaattctccctatatg
agtttttcggccatggcggggaatcctctgctgattagtcctgatcttcttttagaaaag
ggtttactcaatccggaagatttacaagacctgccggaattccccctagattatgtagac
tttgagcaggttattgcttggaaaatgcccatcttgcgaaaagccgctcaaaattttgct
cacaaagcgcctcctgtgatgcggcggagatttgatgggttttgtcaaggtaaagcccat
tggttagaagattatgctctatttatggcactcttagagtcccaagaccagccggtttgg
acagaatggcccagcgagttacgtcatcgccattgggatgctttagaatatgcccgtgag
cagttaaaagaggagatctttttccataaattccttcagtttgagtttatagaacagtgg
ttagaacttagaggttatacgaacaccctaaatattcaaattattggcgatattcccatt
tatgtagggcataacagtgctgatgtttgggctaaccctcaagtgtttaaacttgatccc
gaaaccggcaaccccttagaagtggctggtgttccgccagattatttttcagccaccggt
caattatggggaaatccgctctataactgggaacatttacaacatactgggtttgattgg
tgggtacgtcgtgttcgagaagttctcactcatgttgatctgattcgcatcgatcacttc
cgaggattagaatcttattggtcagttcccgccggcgaaactaccgcaattaatggtcga
tggcttaaagcgcctggttatgctttttttgatacgattcgcgctaagttaggtaaatta
ccgattattgctgaagatttgggggatattgatcaagcggtcttagatctacgggaccat
tatgagtttccgggcatgaagatcttacagtttgcttttgggggtgggtcggataatccc
tatttaccgtttaatgtggagcgtaacagcattatttacacaggaactcatgataacaat
acctctaatggttggtattatgacaatgccaatgaccacgagaaagggcgtttatatcaa
tatatgggctgtacgggtgaatatagcattgcttgggacttgatccgtttagcttatagt
tctgtagccaatcaggcgattattccgctacaagatgtgtttagtttgggttcagatgcg
cggatgaatacccccggtttgtctgatggcaattggggatggcgttaccgcaatgaggcg
ttaatcgaagaatatattcatcgtcttcgggatatggtgcatctttatgggcgctatccg
ggttaa

DBGET integrated database retrieval system