KEGG   Cyanothece sp. PCC 7822: Cyan7822_1201Help
Entry
Cyan7822_1201     CDS       T01310                                 

Definition
magnesium chelatase ATPase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan7822_1201
Enzymes [BR:cyj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan7822_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1312822..1314840)
Genome map
AA seq 672 aa AA seqDB search
MPSLTPTLAKINFPLTAVVGQEAIKLALLLTGVDPGLGGVVIAGRRGTAKSVMARAIHSL
LPPIEIIKDNPFNCDPTKPDEWDDHTQEQYSNTDIPELPKEIIAAPFIQIPIGVTEDRLL
GSVDVEESVKRGEAVFQPGLLASAHRGVLYIDEINLLDDQIANQLLTVLSEGRNTIEREG
LSFQHPCKPLLIATYNPEEGPLREHLLDRIAIALSADGVLALDQRLQAVDRAIGFSNSPQ
AFIEQYNEEIDDLRTQIILAREWLKEVTITHDQIAYLVEEAIRGGVQGHRAEIFAVRVAK
ASAALDGRNTVSAEDLRRAVELVIIPRSIITERPPEQQQTPPPPPPPEPPQDESQQDQDE
PEDENKEEPEQEPDGIPDEFIFDVEGVLLDPSVLYFTQMAQRQGKSGSRSLIFSEDRGRY
VKPMLPKGKVRRIAVDATLRAAAPYQKARRLRHPERNVIVEQGDIRSKRLARKAGALIVF
VVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVALIPFRGEKADVLLPPTRSIALAKRR
LESLPCGGGSPLSHGLTQAVHVGMNAKMSGDIGQVVIVAITDGRGNIPLAKSLGEPPAEG
EKPDIKAELLEIAAKIRGLGMKLLVIDTEKKFVSTGFAKELAAKAGGKYYHLPRATDQAI
ASMAKGAIADMR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccttactcccaccctagctaaaatcaattttccgctcacggctgttgtcgga
caagaagcgatcaaacttgctttgctgttaacaggggttgacccaggactaggaggagtg
gtgatcgcgggtcgtcggggcacagccaaatcagtaatggcgcgggcaattcattcttta
ttgccgccgattgaaattattaaagataacccctttaactgtgaccccactaagccggat
gagtgggatgatcacacccaagagcaatacagtaatactgatattcctgagctacctaaa
gaaattatagccgctccgtttattcaaattcccattggagtgaccgaagaccgcttatta
ggttcggtggatgtagaagagtctgtcaaacgaggtgaggcagtttttcagcctggactc
ttggcatccgcgcaccgaggggtactatatatagatgaaatcaatctcctcgatgatcaa
attgctaaccaactgctaacagttttaagcgaaggcagaaacaccatagaacgagaagga
ctcagttttcagcatccctgtaaacctctgctgatcgccacttataaccccgaagaagga
cccttaagagaacatttattagatagaattgccatcgcgttatcggcagatggggtatta
gccttagatcagcgcttacaggcagtggatcgggcgataggattctctaactcacctcaa
gcctttattgagcagtataacgaagaaatagacgacctgagaacccaaattattttggcg
cgggaatggcttaaagaggtgaccattacccacgatcagatcgcctatttagtggaagaa
gccatcagagggggagtacagggacatcgggccgaaatttttgcggtgcgggtagccaaa
gcatcagccgccctagatggacgtaataccgtaagcgcagaagacctaagacgggcagta
gaattagtgattattccccgttctatcattaccgaaagacccccagaacaacaacaaacc
ccgcccccgccgccgccgcccgaaccccctcaagatgagtctcaacaagaccaagacgaa
cccgaagacgagaataaagaagaacccgaacaagaaccggatgggattccggatgaattt
atctttgatgtcgaaggggttttattagacccgagtgttctttattttactcagatggcc
caaagacaggggaaatccggcagccgcagcttaattttttctgaagatcggggacgttat
gttaaacctatgttacctaaaggcaaggtaagacggattgccgttgatgctactctacgc
gcggcagcgccttatcaaaaagccagacggttgcgtcatccagaacgaaacgttattgtc
gaacaaggagatatccgttctaaacgcttagccagaaaagccggggccttaattgtgttt
gtggtggatgcctctggatcaatggccttaaaccgtatgcagtcagctaaaggtgccgtg
atgcgattattaacagaagcctatgaaaaccgcgatcaggtggctttaattcccttccga
ggagaaaaagctgatgttttattacctccgacaagatccattgccttagccaagagacgc
ttagaaagtttaccctgtggcggcggttctcctttatctcatgggttaactcaggcggtt
catgtgggaatgaatgctaagatgtctggggatattggtcaagtggtgattgtggccatt
actgatggacggggtaatattcctctagcgaagtctttgggtgaaccccccgcagaaggg
gaaaagccagatattaaagcagagttgttagaaattgccgcaaaaattcgcggcttgggg
atgaagttattggtgattgatacagagaaaaagtttgtctctactgggtttgctaaggag
ttagcggctaaagctggcgggaaatattatcatttaccgagggcgacggatcaagcaatt
gcttcgatggcgaaaggagcgatcgcggatatgaggtaa

DBGET integrated database retrieval system