KEGG   Cyanothece sp. PCC 7822: Cyan7822_1428Help
Entry
Cyan7822_1428     CDS       T01310                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cyj00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1561329..1565099
Genome map
AA seq 1256 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAELATERCPQLDIQVFSDRALSETPEVVGTALKDAQVFF
GSLIFDYDQVMWLRQRVQHIPIRLVFESALELMSLTQLGKFVIGDKPKGMPKPIQFILSK
FSSGKEEDKLAGYISFLKTGPKLLKFIPAQKVQDLRNWLIIYGYWNAGGTENVAAMFWTI
AEKYLALKIGEIPTVIETPNMGLLHPDYQGYFPSPQDYLNWYQKHLSLKVDQTPVVGLLL
YRKHVITKQPYIPQLIRYFEAEGLIPLPIFINGVEGHVAVRDWMTTAYETQQRQAGNMAI
PSLSKEAVQVDSIVSTIGFPLVGGPAGSMEGGRRVEVAKQILAAKNVPYIIAAPLLIQDI
YSWTRQGIGGLQSVVLYALPELDGAIDTVPLGGLVGEDIYLIPERVKRLTGRVKNWIKLR
KKLPSERKIAVILYGFPPGYGATGTAALLNVPRSLLKFLQGLKEQGYTVGELPEDGEELI
RRVKEADEGADAHRLTQMEGLSGTRVNVQQLEKWLGYLLRCRIEKQWKSLTDTGIKTIGD
EFYLGGIQLGNIWIGVQPPLGLSGDPMRLMFEKDLTPHPQYAAFYQWLQQDFAADAIVHF
GMHGTVEWLPGSPLGNTGYSWSDILLGNLPNLYIYAANNPSESMLAKRRGYGVLISHNVP
PYGRAGLYKELMALRDLIAEFREDPDKNLALRDPICQKIVDTGLDADCPFEEGQKLGIDF
TVENARLFSRYALCAYFVKVYEYLQIVEQRLFSSGLHILGNPPDEEGLRSYLNAFFAQEL
SEWEFQEILSRQDAKTRQQVGGGPTTAAQKEENSLSKRVREGVEIARLLGQNEDELVNLL
RGLNGEYILPAPGGDLLRDGVGVLPTGRNIHALDPYRMPSAAAYERGREIAKKIIAQHLD
EQGKYPETVAVMLWGLDAIKTKGESLGILLELVGAEPIKEGTGRIVRYELKPLEKVGHPR
IDVLANLSGIFRDTFVNIIELLDDLFERAAQAEESEEENFIRKHALALKAQGVENVSARL
FSNPAGDFGSLVNDQVVDGNWESSEELAKTWQGRNGFSYGRKDKGQARPEVLSELLKTSE
RIVQEIDSVEYGLTDLQEYYGNTGGLKLAAEKQSGKRVTANFVESFSRDTTPRKLEDLLR
LEYRTKLLNPKWGNAMADQGSGGAYEISQRMTALIGWGGTAGFTDNWVYDQAADTYALDA
QMAAKLRSSNPEAFRNIVGRMIEAHGRGFWHPDEEKLQKLQELYELTEDELEGVNN
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgttttgatcgccggttttgaatcctttaacgctgacttataccgcaaa
gccgccgagttagccactgaacgctgtccgcaattagacatacaggtatttagcgatcgc
gccctctcagaaacacccgaagtcgtcggaactgccctcaaagacgctcaagttttcttc
ggcagtcttatctttgattacgatcaagtgatgtggttacgtcaacgagtgcaacacatc
cccatccgcctcgtgtttgaatctgccctagaattgatgagtctcactcaattgggtaaa
ttcgtcatcggcgataaacccaaaggaatgccgaaacccattcaatttatcctcagtaaa
ttttcaagcggcaaagaagaagataaactcgccggctatattagctttctcaaaaccgga
ccaaaactgctcaaatttatccccgcgcaaaaagttcaagacttacgcaactggctcatc
atttacggctattggaatgctggcggcacagaaaatgtcgccgctatgttttggaccatt
gccgagaaatatttagccttaaaaatcggtgaaattcccacagtcatcgaaacccctaac
atgggattacttcatcccgactatcaaggttattttccctctcctcaagattatttaaat
tggtatcaaaaacatttatctttaaaagttgatcaaactcccgtagttggccttctcctc
tatcgtaagcacgttattactaaacagccctatattccccaactgattcgttattttgaa
gccgaaggactcatccccctaccaatttttattaatggcgtagaagggcacgtggcggtt
agagattggatgacaaccgcttatgaaacccaacaacgtcaagcgggaaatatggctatt
ccttctttatctaaagaagctgtacaagtcgattccattgtgtctaccattggctttcct
ctagtgggaggtcctgccggttctatggaaggcggtagaagagtagaagtcgctaaacaa
attttagccgctaaaaatgtcccttatattatcgctgcaccgttattaattcaagatatt
tattcttggaccagacagggcattggcggcttacaaagtgtggttttatatgccttaccg
gagttagatggggccattgatactgtgccattaggcggcttagtgggagaagatatttat
ctcattcctgaacgagtgaaacgcctcacaggaagggtgaaaaattggattaaattaaga
aaaaaattgccttcggaacgaaaaatagcggtaattttatatgggtttccgccaggttat
ggggcaaccggtacggcggcgttattgaatgtcccccgctcgcttttaaaatttttacaa
gggttaaaagagcaaggatatactgtcggagaattgcccgaagatggcgaagaattgatc
cgtcgcgttaaagaggccgatgagggagcagatgcacacagattaacacagatggagggt
ttatcagggacaagggttaatgtacaacaattagaaaaatggttggggtatttgttgagg
tgccgcattgaaaaacagtggaagtctttgacggatacgggcataaaaaccattggcgat
gagttttatcttggggggattcaattaggaaatatttggatcggcgttcaacctcccttg
gggctttcgggtgatccgatgcggctaatgttcgagaaagatttaacccctcatcctcaa
tatgcggctttttatcagtggttacaacaggattttgccgccgatgccattgttcatttt
ggtatgcacggaacagtagaatggttgccgggttctcctttgggaaatacgggctattct
tggtctgatattttgttaggaaatctgccgaatttatatatttatgcggccaataatccg
tctgagtcgatgttggctaaacgtcgcggttatggggttttgatttctcataatgtgccg
ccctatggacgggctgggttatataaagagttgatggctttgcgtgatttgattgctgag
tttcgcgaagatcctgacaagaatttagcactaagagacccgatttgtcagaaaattgtt
gatacgggtttggatgcggattgtccttttgaagaggggcaaaagttagggattgatttt
actgtggaaaatgcgcggctgtttagtcgttatgcactttgtgcttattttgtcaaggtg
tatgagtatttacaaattgttgagcaacggctgttttcttcggggttacatattttgggt
aatcctccggatgaggaggggttacggtcttatttgaatgctttttttgcccaggagtta
tcggagtgggaatttcaagagattctgtcgcgccaagacgcaaagacaaggcagcaggtt
gggggaggtccaacgactgccgcgcaaaaagaggaaaatagtctgtcaaaaagggttagg
gagggggtggagattgctcgtttgttgggacaaaatgaggatgagttggtcaatctttta
agggggttgaatggggagtatattttgccggctcctgggggtgatttgttacgggatggg
gtgggtgtgttaccgacgggacgaaatattcatgctttagatccttatagaatgccgtcg
gcggcggcttatgaaagaggccgggaaattgctaagaaaattattgctcaacatttagat
gaacagggtaaatatccggaaacggtggcggtgatgttgtggggtttggatgctattaag
actaagggtgaatctttggggattctgttagaattggtgggggctgaaccgattaaggaa
ggaaccggaagaattgttagatatgagttaaaacccctggaaaaagtgggacatccccgg
attgatgttttggcgaatttatcggggatttttcgggatacatttgttaatattattgag
ttgttggatgatttatttgaacgagcggctcaggcagaagaatcagaagaagaaaatttt
attcgtaagcacgctttggcgttaaaggcgcagggagttgagaatgtttcagcccgttta
ttttctaatccggcgggagattttggctcgttagtgaatgatcaagtggtggatggaaat
tgggagtcttctgaagaattagcgaagacttggcaaggaagaaatgggtttagttatggg
agaaaagataaaggacaagcacgccctgaagtgctgagcgagttgctaaaaaccagtgaa
agaattgtacaggaaattgattctgtggagtatgggttaactgatcttcaagaatattat
ggcaataccggcggactaaaattagcggcagaaaaacaaagcggcaaacgggtaacggct
aattttgttgaaagtttttctcgtgatacgactccccggaaattagaagatttattgagg
ttggaatatcgaactaaattattaaatcctaaatggggaaatgctatggcagatcagggt
tcggggggagcttatgaaatttctcagcgcatgacagctttgatcggttggggaggaact
gccggatttaccgataattgggtgtatgatcaagcggccgatacttatgctttagatgct
caaatggcggctaaattacgctcatctaatcccgaagcttttcgtaatattgttgggcgc
atgatagaagctcatgggcgcggtttttggcatccagatgaggagaaattgcaaaagtta
caagaattatatgagttaacagaggacgaactcgaaggggtaaataattaa

DBGET integrated database retrieval system