KEGG   Cyanothece sp. PCC 7822: Cyan7822_1428Help
Entry
Cyan7822_1428     CDS       T01310                                 

Definition
(GenBank) magnesium chelatase, H subunit
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00860  Porphyrin and chlorophyll metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan7822_1428
Enzymes [BR:cyj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan7822_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel DUF3479
Motif
Other DBs
NCBI-ProteinID: ADN13425
JGI: Cyan7822_1428
UniProt: E0UJR4
Position
1561329..1565099
Genome map
AA seq 1256 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAELATERCPQLDIQVFSDRALSETPEVVGTALKDAQVFF
GSLIFDYDQVMWLRQRVQHIPIRLVFESALELMSLTQLGKFVIGDKPKGMPKPIQFILSK
FSSGKEEDKLAGYISFLKTGPKLLKFIPAQKVQDLRNWLIIYGYWNAGGTENVAAMFWTI
AEKYLALKIGEIPTVIETPNMGLLHPDYQGYFPSPQDYLNWYQKHLSLKVDQTPVVGLLL
YRKHVITKQPYIPQLIRYFEAEGLIPLPIFINGVEGHVAVRDWMTTAYETQQRQAGNMAI
PSLSKEAVQVDSIVSTIGFPLVGGPAGSMEGGRRVEVAKQILAAKNVPYIIAAPLLIQDI
YSWTRQGIGGLQSVVLYALPELDGAIDTVPLGGLVGEDIYLIPERVKRLTGRVKNWIKLR
KKLPSERKIAVILYGFPPGYGATGTAALLNVPRSLLKFLQGLKEQGYTVGELPEDGEELI
RRVKEADEGADAHRLTQMEGLSGTRVNVQQLEKWLGYLLRCRIEKQWKSLTDTGIKTIGD
EFYLGGIQLGNIWIGVQPPLGLSGDPMRLMFEKDLTPHPQYAAFYQWLQQDFAADAIVHF
GMHGTVEWLPGSPLGNTGYSWSDILLGNLPNLYIYAANNPSESMLAKRRGYGVLISHNVP
PYGRAGLYKELMALRDLIAEFREDPDKNLALRDPICQKIVDTGLDADCPFEEGQKLGIDF
TVENARLFSRYALCAYFVKVYEYLQIVEQRLFSSGLHILGNPPDEEGLRSYLNAFFAQEL
SEWEFQEILSRQDAKTRQQVGGGPTTAAQKEENSLSKRVREGVEIARLLGQNEDELVNLL
RGLNGEYILPAPGGDLLRDGVGVLPTGRNIHALDPYRMPSAAAYERGREIAKKIIAQHLD
EQGKYPETVAVMLWGLDAIKTKGESLGILLELVGAEPIKEGTGRIVRYELKPLEKVGHPR
IDVLANLSGIFRDTFVNIIELLDDLFERAAQAEESEEENFIRKHALALKAQGVENVSARL
FSNPAGDFGSLVNDQVVDGNWESSEELAKTWQGRNGFSYGRKDKGQARPEVLSELLKTSE
RIVQEIDSVEYGLTDLQEYYGNTGGLKLAAEKQSGKRVTANFVESFSRDTTPRKLEDLLR
LEYRTKLLNPKWGNAMADQGSGGAYEISQRMTALIGWGGTAGFTDNWVYDQAADTYALDA
QMAAKLRSSNPEAFRNIVGRMIEAHGRGFWHPDEEKLQKLQELYELTEDELEGVNN
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgttttgatcgccggttttgaatcctttaacgctgacttataccgcaaa
gccgccgagttagccactgaacgctgtccgcaattagacatacaggtatttagcgatcgc
gccctctcagaaacacccgaagtcgtcggaactgccctcaaagacgctcaagttttcttc
ggcagtcttatctttgattacgatcaagtgatgtggttacgtcaacgagtgcaacacatc
cccatccgcctcgtgtttgaatctgccctagaattgatgagtctcactcaattgggtaaa
ttcgtcatcggcgataaacccaaaggaatgccgaaacccattcaatttatcctcagtaaa
ttttcaagcggcaaagaagaagataaactcgccggctatattagctttctcaaaaccgga
ccaaaactgctcaaatttatccccgcgcaaaaagttcaagacttacgcaactggctcatc
atttacggctattggaatgctggcggcacagaaaatgtcgccgctatgttttggaccatt
gccgagaaatatttagccttaaaaatcggtgaaattcccacagtcatcgaaacccctaac
atgggattacttcatcccgactatcaaggttattttccctctcctcaagattatttaaat
tggtatcaaaaacatttatctttaaaagttgatcaaactcccgtagttggccttctcctc
tatcgtaagcacgttattactaaacagccctatattccccaactgattcgttattttgaa
gccgaaggactcatccccctaccaatttttattaatggcgtagaagggcacgtggcggtt
agagattggatgacaaccgcttatgaaacccaacaacgtcaagcgggaaatatggctatt
ccttctttatctaaagaagctgtacaagtcgattccattgtgtctaccattggctttcct
ctagtgggaggtcctgccggttctatggaaggcggtagaagagtagaagtcgctaaacaa
attttagccgctaaaaatgtcccttatattatcgctgcaccgttattaattcaagatatt
tattcttggaccagacagggcattggcggcttacaaagtgtggttttatatgccttaccg
gagttagatggggccattgatactgtgccattaggcggcttagtgggagaagatatttat
ctcattcctgaacgagtgaaacgcctcacaggaagggtgaaaaattggattaaattaaga
aaaaaattgccttcggaacgaaaaatagcggtaattttatatgggtttccgccaggttat
ggggcaaccggtacggcggcgttattgaatgtcccccgctcgcttttaaaatttttacaa
gggttaaaagagcaaggatatactgtcggagaattgcccgaagatggcgaagaattgatc
cgtcgcgttaaagaggccgatgagggagcagatgcacacagattaacacagatggagggt
ttatcagggacaagggttaatgtacaacaattagaaaaatggttggggtatttgttgagg
tgccgcattgaaaaacagtggaagtctttgacggatacgggcataaaaaccattggcgat
gagttttatcttggggggattcaattaggaaatatttggatcggcgttcaacctcccttg
gggctttcgggtgatccgatgcggctaatgttcgagaaagatttaacccctcatcctcaa
tatgcggctttttatcagtggttacaacaggattttgccgccgatgccattgttcatttt
ggtatgcacggaacagtagaatggttgccgggttctcctttgggaaatacgggctattct
tggtctgatattttgttaggaaatctgccgaatttatatatttatgcggccaataatccg
tctgagtcgatgttggctaaacgtcgcggttatggggttttgatttctcataatgtgccg
ccctatggacgggctgggttatataaagagttgatggctttgcgtgatttgattgctgag
tttcgcgaagatcctgacaagaatttagcactaagagacccgatttgtcagaaaattgtt
gatacgggtttggatgcggattgtccttttgaagaggggcaaaagttagggattgatttt
actgtggaaaatgcgcggctgtttagtcgttatgcactttgtgcttattttgtcaaggtg
tatgagtatttacaaattgttgagcaacggctgttttcttcggggttacatattttgggt
aatcctccggatgaggaggggttacggtcttatttgaatgctttttttgcccaggagtta
tcggagtgggaatttcaagagattctgtcgcgccaagacgcaaagacaaggcagcaggtt
gggggaggtccaacgactgccgcgcaaaaagaggaaaatagtctgtcaaaaagggttagg
gagggggtggagattgctcgtttgttgggacaaaatgaggatgagttggtcaatctttta
agggggttgaatggggagtatattttgccggctcctgggggtgatttgttacgggatggg
gtgggtgtgttaccgacgggacgaaatattcatgctttagatccttatagaatgccgtcg
gcggcggcttatgaaagaggccgggaaattgctaagaaaattattgctcaacatttagat
gaacagggtaaatatccggaaacggtggcggtgatgttgtggggtttggatgctattaag
actaagggtgaatctttggggattctgttagaattggtgggggctgaaccgattaaggaa
ggaaccggaagaattgttagatatgagttaaaacccctggaaaaagtgggacatccccgg
attgatgttttggcgaatttatcggggatttttcgggatacatttgttaatattattgag
ttgttggatgatttatttgaacgagcggctcaggcagaagaatcagaagaagaaaatttt
attcgtaagcacgctttggcgttaaaggcgcagggagttgagaatgtttcagcccgttta
ttttctaatccggcgggagattttggctcgttagtgaatgatcaagtggtggatggaaat
tgggagtcttctgaagaattagcgaagacttggcaaggaagaaatgggtttagttatggg
agaaaagataaaggacaagcacgccctgaagtgctgagcgagttgctaaaaaccagtgaa
agaattgtacaggaaattgattctgtggagtatgggttaactgatcttcaagaatattat
ggcaataccggcggactaaaattagcggcagaaaaacaaagcggcaaacgggtaacggct
aattttgttgaaagtttttctcgtgatacgactccccggaaattagaagatttattgagg
ttggaatatcgaactaaattattaaatcctaaatggggaaatgctatggcagatcagggt
tcggggggagcttatgaaatttctcagcgcatgacagctttgatcggttggggaggaact
gccggatttaccgataattgggtgtatgatcaagcggccgatacttatgctttagatgct
caaatggcggctaaattacgctcatctaatcccgaagcttttcgtaatattgttgggcgc
atgatagaagctcatgggcgcggtttttggcatccagatgaggagaaattgcaaaagtta
caagaattatatgagttaacagaggacgaactcgaaggggtaaataattaa

DBGET integrated database retrieval system