KEGG   Cyanothece sp. PCC 7822: Cyan7822_1532Help
Entry
Cyan7822_1532     CDS       T01310                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cyan7822_1532
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cyan7822_1532
Enzymes [BR:cyj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cyan7822_1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1672387..1674804)
Genome map
AA seq 805 aa AA seqDB search
MKNLITLPEIPPFAWKRPIGKAWDNPYTVRYNSNLDDGPWHGVPLGGFGAGCIGRSPKGD
FNLWHLDGGEHIFRTLAACQFSIFEQPEGGEAQAYALSTEPPEDGTLSRWSWYPTEKGTY
HALYPRSWYEYEGVFQTKIICEQYSPIWAGNYQETSYPVAIFAWTIHNPTDRPITLSIMM
SWQNTVGWFSNAIKTPEVKVRDDGSPVYEYQPRWGDSTGNYNQWIVDNFRVGCLLNRIQP
HPQVQEGEGQLCIASILNPSVEVFYNTRWNPMGDGSEIWDYFAMNGMLGDYENESAAAPG
EQIAAAMAIRFTIPPGKTRLIPFILAWDLPITEFSQGINYYRRYTDFFGRNGQNVWSVVR
TALKNVDIWRDRIIDWQSPILKDQDLPDWFKMALFNELYLLADGGTLWTAATEDDPVGQF
AVLECIDYRWYESLDVRLYGSFALGMLWPRLDKAVMEAFARAIPQADDTPRIIGYNGAKA
IRKAKGATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLGSDFVLLLYRSFLWTGGNNQDYL
WEHWHSVTETLAYLKAFDLDGDGIPENSGAPDQTFDDWQLRGISAYCGALWIAALEAAIK
MGEILLQRPPMNPQLQPQNAAESIEEAITTYRHWLQQARSLYHDTLWNGEYYRLDSESGS
DVVMSDQLCGQFYARLLGLPDVVEPQYTTSALRKIYEACFLKFHGGKYGAANGVKPDGTP
ENPDATHPLEVWTGINFGLAAFMIQMGMKEEAFKITEAVVKQVYENGLQFRTPEAITAVG
TFRASHYLRAMAIWAVYGILKGFKS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacctgatcaccctacccgaaatcccccctttcgcttggaaacgtcccatcggc
aaagcatgggacaacccctacaccgttcgctacaacagtaacttagacgatggcccttgg
catggagtgccccttggtgggtttggtgccggctgtatcggacgttccccaaaaggagat
tttaacctctggcatctcgacggcggcgaacacatctttcgcactcttgccgcttgtcaa
tttagcatctttgaacaacctgaaggcggagaggcccaagcttatgccctttccactgaa
cccccagaagacggaaccctttcgcgttggtcttggtatcctactgaaaaaggaacctat
cacgccctctatccccgcagttggtatgaatacgagggagtctttcaaacaaaaattatc
tgtgagcaatattcccccatttgggcaggaaactatcaagaaactagctatccggtagct
atctttgcatggactattcataaccctaccgatcgccccatcaccctcagcatcatgatg
tcgtggcaaaatacagtaggctggtttagcaatgctatcaaaacccccgaagttaaagtc
agagatgatggaagtcccgtctatgaatatcaaccccgatggggcgatagtaccggcaac
tataatcagtggatagtcgataattttcgagtgggttgtttactcaaccgcattcaaccc
cacccacaagtccaagaaggcgaaggacaactgtgcatcgccagcatccttaaccccagt
gtagaagttttttataatacccgttggaacccaatgggggatggatcagaaatttgggat
tattttgctatgaatgggatgctaggagattatgaaaatgaatctgctgccgcacccggt
gaacaaattgccgccgccatggccattcgttttactatccccccgggtaaaactcgcctc
attccttttatcctcgcttgggacttacccattaccgaattttcccaaggaattaattat
tatcgccgctataccgactttttcggacgcaacgggcaaaatgtctggtcagtggtgcgg
acagccctaaaaaacgttgatatctggcgggatcggattatagactggcagtctcctatt
ctcaaggaccaagacttacctgactggttcaaaatggctttatttaatgaattatattta
ctcgccgatggggggacattatggacagccgctacagaagatgacccggtaggacagttt
gctgttcttgaatgtatagattatcgttggtatgaaagcctcgatgtgcgtttatatgga
tcatttgcgttagggatgttatggccccgcttagataaagcagtaatggaagcgtttgct
agggcaattcctcaagccgatgataccccgagaattatcggttataacggggcaaaagcg
attcgtaaagctaaaggggcaactccccatgatttaggggcccccaatgaacatccttgg
gaaaaaaccaattacaccagttatcaagattgcaatctttggaaagatttagggtcggat
tttgttttactgctgtatcggtcttttttgtggaccggaggcaataatcaagattattta
tgggaacattggcattcggttactgaaactttagcttatctcaaagcatttgacctagat
ggggacgggatacccgaaaattccggggcacccgatcaaacttttgatgattggcaatta
cggggaattagtgcttattgtggcgcgttgtggatagccgccttagaagctgccataaaa
atgggtgaaatcttgctgcaacgtccccccatgaacccccaattacaaccgcaaaatgcg
gcagaatcgatcgaggaagccatcacgacttaccgtcattggttacaacaggcgaggtct
ttatatcatgatactctctggaatggggaatattaccgcctcgatagtgagagtggttcg
gatgtggtgatgagtgatcaactttgtggtcaattttacgcccgtttgttagggttgccg
gatgtggtggaacctcaatacaccacctctgctttaagaaagatttatgaagcctgtttt
ttaaagtttcatgggggaaaatatggggcggctaatggcgttaaacccgatggaacgcca
gaaaatcctgatgctactcatcccctagaagtatggacgggaattaattttggcttagcg
gcttttatgatacaaatggggatgaaagaagaagcatttaagattactgaagcggttgtt
aaacaggtgtatgaaaatggcttacaatttcggactccagaagcgataacggcagtggga
acttttcgggctagtcattatcttagggcaatggctatttgggcagtttatggaatttta
aaaggatttaaaagctaa

DBGET integrated database retrieval system