KEGG   Cyanothece sp. PCC 7822: Cyan7822_1594Help
Entry
Cyan7822_1594     CDS       T01310                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cyan7822_1594
Enzymes [BR:cyj01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Cyan7822_1594
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Cyan7822_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1743343..1743903
Genome map
AA seq 186 aa AA seqDB search
MAILRLEDGTTYTDLEKIASELAALNIQLNYWSVGDATNTQHLLELAALSEEEKEQVLQA
LDHYFEQLQQSYGYQSRDLIVLHPNIPNLDVLMSKFERCHTHADDEVRYIIDGEGVFGFV
RPDGSQVELTVEPEEYVNVPAGTEHWFHLTEKKRIKAVRYFITTEGWVPEYTETEIRFPS
LAIAAN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcaattttacgtttagaagatggaacaacctacacagatttagaaaaaattgcatcg
gaattagccgccctaaacattcaattaaactattggagcgtaggcgatgctaccaatacc
caacacttactcgaattagccgccttatcagaagaagaaaaagagcaagttttacaagca
ttagaccactactttgagcaacttcaacaaagttatggttatcaatctcgggacttaatc
gtgcttcatcctaatattcccaacttagatgttttaatgagcaaatttgaacgctgtcac
actcatgccgatgatgaagtccgttatattattgacggtgaaggagtatttggatttgta
cgtcctgatggctctcaagttgaattaaccgttgaacccgaagaatatgtcaatgttcct
gcggggacagaacactggtttcatttaacagagaaaaaacgcattaaagcagtacgttat
tttattactaccgaaggatgggttcctgaatataccgagacagaaattcgctttccgtca
ttagctatagcggctaactaa

DBGET integrated database retrieval system