KEGG   Cyanothece sp. PCC 7822: Cyan7822_1604Help
Entry
Cyan7822_1604     CDS       T01310                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cyan7822_1604
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_1604
   00620 Pyruvate metabolism
    Cyan7822_1604
   00650 Butanoate metabolism
    Cyan7822_1604
  Lipid metabolism
   00071 Fatty acid degradation
    Cyan7822_1604
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cyan7822_1604
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cyan7822_1604
   00626 Naphthalene degradation
    Cyan7822_1604
Enzymes [BR:cyj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cyan7822_1604
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cyan7822_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1751948..1754611
Genome map
AA seq 887 aa AA seqDB search
MKVTNIPELEVLIQRTKAAQEIYATYSQEQVDEIFKKAALAANAARIPLAKMAVAETGMG
VIEDKVIKNHFASEIIYNKYKQDKTCGVIEEDKSFGFQKIAEPVGLVAGIVPTTNPTSTA
IFKALITLKTRNGIIFSPHPRAKNCTIEAARIILEAAVEAGAPEGLIGWIDEPSVELSQA
LMQHPQISLILATGGPGMVKAAYSSGRPSLGVGAGNTPALIDDTAHIKMAVSSIILSKTF
DNGMICASEQSVVVVDSIYEQVKQEFIERGAYFLNPQEKEQLGKVLIVDGHLNASIVGQS
VQKLAELAGLNIPEESRVLIAEIEEIGYSEPFAYEKLSPVLGMYRASDFIDGVKVAEQLV
EFAGKGHTAVLYTAPSNKDHIRRFEEKIETARVLINTPSSQGAIGDIYNFRLDPSLTLGC
GTWGGNSISENVEPRHLLNVKTVAERRENMLWFRVPPKIYFKYGALPIAIRELAGKQRAF
IVTDKPIYDLGMTRSLEEVLDEIGLRYNIFYDVEPDPSLETVNRGLALMRDFNPDVIIAI
GGGSPMDAAKIMWLLYEHPEIEFDGLAMRFMDIRKRVYELPPLGQKALLVAVPTTSGTGS
EVTPFAVVTDRRKNIKYPLADYALTPSMAVVDPELVLNMPKSLTAYGGLDALTHATEAFV
SVLASEYTTGLALEAIRLIFKYLPSAYQNGGKDSKAREKIHYAATMAGMAFANSFLGICH
SMAHQLGAVFHVPHGLANAMLISYVIRYNATDAPFKQATFSQYKYPNAIWRYARIADYLG
LGGVTREEKVDRLIEVIEDLKRRLDIPTALKDVIPVGEAEFLVKVDEIADQAFDDQCTGS
NPRYPLIQDLRELLLKAYYGESPINTNGDERRHLTLADVKTDPQPIA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacaaacatcccagaactcgaagtattgatccaaagaacaaaagccgcccag
gaaatttacgccacctatagccaagaacaggtagacgaaattttcaaaaaagcggcacta
gcggctaatgcagcccgtatccccttagctaaaatggcggtagccgaaactggcatgggt
gtgatcgaagataaagtgattaaaaatcattttgcctcagaaatcatctataacaaatat
aaacaggataaaacctgcggcgtaatcgaagaagataaatccttcggctttcaaaaaatt
gccgaacccgtaggacttgtagccggcatcgttcccaccactaaccccacctccacagct
atatttaaagccctcatcaccctaaaaacccgcaacggcattatcttttcccctcatccc
cgcgccaaaaactgcaccatcgaagccgcgagaattatccttgaggcagccgtagaagca
ggtgccccagaaggtttgatcggttggatagatgaaccttcggtagaactctctcaggcc
ttaatgcaacatccccaaattagcctcattttagccacaggcggccccggcatggtgaaa
gcggcttattcatcgggtcgtccctctttaggggtaggcgcaggcaataccccggcttta
attgatgataccgctcatattaaaatggctgtttcctcgattatcctcagtaaaaccttt
gataatggcatgatatgtgcatcggaacagtcggtagtggtggtagattccatttatgaa
caggtcaaacaagagtttattgaacggggtgcttatttcctcaacccccaagaaaaagag
caattaggaaaagttttaatcgttgatggtcaccttaatgctagtatagtgggccaatct
gtgcaaaaattagccgaattagccggtttaaacatacccgaagagagtcgcgttctcatt
gccgaaatagaagagattggttatagtgaaccctttgcttatgaaaaattatctcccgtt
ttagggatgtatcgggccagtgattttatcgatggagtcaaggttgccgaacagttagtc
gaatttgccggtaaaggccataccgccgttttatatactgcaccctccaataaagaccat
atccgacgttttgaagaaaaaattgaaaccgcccgggttttaattaatactccctcctca
caaggggccatcggagatatctataatttccgtttagatccctctcttaccctcggatgc
ggaacttggggcggtaactccattagtgaaaatgtcgaaccccgtcatttactgaatgtt
aaaaccgtagccgaacgacgggaaaatatgctctggttccgagtccctccgaagatttat
tttaaatatggggccttaccgattgctattcgagaattagccggaaaacaacgggccttt
attgtcactgacaaaccgatttatgatttaggcatgacccgttccctagaagaagtcctc
gacgaaatcggcttaagatacaatattttttatgatgtggaacccgatccctctttagaa
accgtcaatcgtggtttagccctgatgcgggattttaaccccgatgtgatcatcgccatt
ggtggaggttctccgatggatgcggctaaaattatgtggctgttgtacgaacatccagaa
atagaatttgatgggttagcgatgcgctttatggacatccgtaaacgggtgtatgaattg
ccgcctcttggacaaaaagccctcttagtcgccgttcccaccacttccggcaccggatca
gaagttaccccctttgcagtggtgactgatcgacgcaagaatattaaatatcctctggca
gactacgccttaaccccctcaatggccgttgtcgatcccgagttagtcttaaatatgcct
aagtcccttaccgcttacggcggactggacgcgctaacccatgccacagaagcctttgtc
tcggtattagcctcagaatataccaccggactcgccctagaagcgattcgactcatcttt
aaatatctcccgagtgcttaccaaaacggcggcaaagactcgaaagcccgcgaaaaaatt
cattatgcggctacgatggccggtatggcttttgcgaacagctttttaggcatttgtcac
tccatggcccatcaattaggggcagtgtttcatgtgcctcacgggttagctaatgccatg
ttgatctcctatgtcatccgttacaatgcaaccgatgcgccctttaaacaagctaccttc
tctcaatataaatatcctaatgctatctggcgttatgcccgtattgcggattatttggga
ttaggcggcgtaactcgtgaagaaaaagtagatcgcttaatagaagtgatcgaagacctc
aaacgtcggttagatattcccacagccctcaaagacgttattccggtgggagaagccgaa
tttttggttaaagtggatgaaatagccgatcaagcctttgatgatcaatgtacaggttcc
aatcctcgttatcctctaattcaggatttgagagaactattactaaaggcttattatgga
gagtctcccattaataccaatggcgacgaacgcagacatctaaccttagccgatgtcaaa
accgatcctcaaccgatcgcctaa

DBGET integrated database retrieval system