KEGG   Cyanothece sp. PCC 7822: Cyan7822_1609Help
Entry
Cyan7822_1609     CDS       T01310                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1760882..1761727
Genome map
AA seq 281 aa AA seqDB search
MNHITIRDQLFEWGKRTYLMGILNVTPDSFSDGGQFNTLDAALEQAAKMVAEGADIIDLG
GQSTRPGAEEISLDEELKRVIPVIKALRPLISVPISIDTTRAAVARAAIEAGADLINDIS
GGTFDEQMFLVAATLDVPIILMHIRGTPKTMQQLTDYQDLIREISEFFANQILKAMAIGI
KRSHLMIDPGLGFAKTDQQNLEILRQINQFRSLDVPILVGPSRKRFIGHILQQKDPQQRV
WGTAAACCAAIASGADLLRVHDVKPMSEVCRVADAIWRNHQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacataaccatccgcgatcaactcttcgagtggggaaagcgaacttacctcatg
ggaattttaaacgttactcctgacagttttagtgatggaggacaatttaacactctcgat
gctgccttagaacaagccgctaaaatggtagccgagggagcagatattattgatctcggt
ggacagtccacccgccccggtgcagaagaaatttctttggatgaagaacttaagcgagtt
attcctgtgattaaagctttacggccattaatttctgtgcccatttctattgataccaca
agagccgccgtagcgcgagcagcgattgaagccggagcagacctcattaatgatatctct
ggaggaacctttgatgagcaaatgttcttggtagcggcaacattagatgtgcccattatt
ttaatgcacattcggggaactcccaaaaccatgcagcaattaacagattatcaggattta
attcgagaaataagcgagtttttcgctaatcaaattttaaaagctatggctataggcata
aagcgttcccatttaatgattgatccgggtcttgggtttgccaaaactgatcagcaaaat
ttagaaatcctcagacaaattaaccaatttcggagtttagatgtgcccattttagtaggg
ccttctcgtaagcgttttatcggtcatattttgcagcaaaaagaccctcagcagcgtgtt
tggggaacggcggcggcttgttgtgcggccatcgcatcgggagccgatcttttaagagtt
cacgacgttaaacctatgtctgaagtctgtcgggttgcggatgccatctggcgaaatcat
caatag

DBGET integrated database retrieval system