KEGG   Cyanothece sp. PCC 7822: Cyan7822_1688Help
Entry
Cyan7822_1688     CDS       T01310                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_1688
   01230 Biosynthesis of amino acids
    Cyan7822_1688
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_1688
   00051 Fructose and mannose metabolism
    Cyan7822_1688
   00562 Inositol phosphate metabolism
    Cyan7822_1688
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7822_1688
Enzymes [BR:cyj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cyan7822_1688
Exosome [BR:cyj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cyan7822_1688
  Exosomal proteins of bladder cancer cells
   Cyan7822_1688
  Exosomal proteins of melanoma cells
   Cyan7822_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1842757..1843449
Genome map
AA seq 230 aa AA seqDB search
MYKTQAEALEFVQTFKSKVDNTNESREIVLCAPFTTLGAMSKNLHGSRIRLGAQNIHWED
AGAYTGEIAGPMLTEIGVNYVIIGHSERRQYFGETDETVNLRLLAAQKHGLIPILCVGES
KSQRDAGETEKIIINQLKRDLVDVDQNNLVIAYEPIWAIGTGDTCESTEANRVIGLIREQ
LTNKNVPIQYGGSVKPNNIDEIMKQSEIDGALVGGASLDPADFASIVNYQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagactcaagcagaagctttagagtttgtgcaaacatttaaatccaaagtagac
aatacaaacgaatctagagaaattgtcctctgtgccccgtttacaactttaggagccatg
tctaaaaatttacatgggagccgcattaggttaggggcacaaaatatccactgggaagat
gccggtgcttatacaggtgaaattgcaggacctatgcttaccgaaatcggggttaattac
gtgattattggtcacagcgaacgccgccagtatttcggagaaaccgatgaaactgtcaat
ttacgactccttgccgctcaaaaacatggcttgattcctattctgtgcgtcggggaatct
aaatcacaacgagatgccggtgaaaccgaaaagattatcattaatcaattaaaacgagat
ttggtagatgtagatcaaaataatctcgtgattgcttatgaacctatctgggccattgga
accggtgacacttgtgaatccactgaagctaaccgagtgattggtttaattcgagagcag
ttgaccaataaaaatgttccgattcagtatggcggctccgttaaacccaataatattgat
gaaattatgaaacaatcggaaatagatggggctttagtcgggggagctagtttagatccg
gcagattttgctagtattgttaattatcaatag

DBGET integrated database retrieval system