KEGG   Cyanothece sp. PCC 7822: Cyan7822_1713Help
Entry
Cyan7822_1713     CDS       T01310                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cyan7822_1713
DNA repair and recombination proteins [BR:cyj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cyan7822_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1868401..1868958)
Genome map
AA seq 185 aa AA seqDB search
MQRLPGVGPKTAQRLALHILKRPEEEVNTLAKAIIEAKKQVGLCQVCFHLSAESVCEICR
NPNRNNNIICVVADSRDVIALEKTREYGGKYHVLGGVISPMDGIGPEQLNISALVRRVSQ
QKVQEVILAISPSVEGETTTLYVGQLLKPFTLVTRIAFGLPMGGDLEYADEVTLARALEG
RRELD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgtttacccggcgtgggtccaaaaaccgcccaacgcttagccctacatatcctc
aaacgtccagaagaagaagttaacaccttagccaaagcgatcatagaagccaaaaaacaa
gtaggattatgtcaagtttgctttcatctctcggccgagtcagtttgtgaaatttgccgc
aacccgaatcgaaataataatatcatttgtgtcgttgcagactctcgagatgtgatcgcc
ctagaaaagactcgagaatatgggggaaaatatcacgttttagggggtgttatttcgccg
atggatggcatcggacccgaacaattaaatattagtgccttagtgaggcgagtcagccag
cagaaggtacaagaagtcattttagccatcagtcctagtgtagaaggagagaccaccacc
ctctatgttggtcaactgttaaaaccctttacgctagtaacccgcattgccttcggttta
ccgatggggggagacctggaatatgcagatgaggtaactctagccagggcattagaagga
cgacgagaattagactaa

DBGET integrated database retrieval system