KEGG   Cyanothece sp. PCC 7822: Cyan7822_1715Help
Entry
Cyan7822_1715     CDS       T01310                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan7822_1715
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7822_1715
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan7822_1715
Enzymes [BR:cyj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan7822_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1869557..1870867)
Genome map
AA seq 436 aa AA seqDB search
MTQATQTQSNTSSFIPTFKSLVSKEGGIEYPLEALHVCEETFSPLEVAYDYDLIRRQVSR
ETIEAGPNSIWRYRAFLPVATDNYIDLGTGMTPLVKSHRLARRLGLKNLYIKNDAVNMPT
LSFKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAASAGLDCCVFIPADLEAGKIL
GTLIYNPTLMAVKGNYDQVNRLCCEVGNSYGWGFVNINLRPYYSEGSKTLGFEVAEQLGW
KLPDHIVAPLASGSLYTKIYKGFQEFVKVGLVDEKPVRFSGAQAEGCSPIAKAFSENRDF
VSPVKPNTIAKSIAIGNPADGVYALEIARKTGGHIESVNDSEIIEGIKLLAETEGIFTET
AGGTTIAVLKKLVEAKKIDPEETTVVYITGNGLKTQEAVQGYIGEPLVIDANLDSFERAL
ERSRTLERLEWQQVLV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcaacccaaactcaatcaaacacttctagctttatccccacctttaaatcg
ctcgtttcaaaagaagggggtatcgaatacccactcgaagcccttcacgtctgcgaagaa
acgttctcacccttagaagtggcttatgactatgatttaattcgtcgtcaggtaagccga
gaaacgattgaagcgggtccgaattcgatttggcgttatcgcgccttcttacccgttgcc
actgacaactacattgacttaggaactgggatgactcccctcgtgaaatcccatcgttta
gcccgtcgcctgggtctaaaaaacctctacatcaaaaacgatgctgtcaatatgccgacc
ctgagttttaaagaccgggtggtgtcggttgccctcagtagagccagagaattaggcttt
accaccgtttcttgtgctagtaccggcaacttagccaattctacagccgctatagccgcc
agtgcaggcttagactgttgtgtgttcatccccgccgatttagaagccggcaaaatcttg
ggaaccttaatttataatccaaccttaatggcggttaaaggcaactacgaccaagttaac
cgcctctgttgtgaagtgggaaatagctatggctggggatttgtcaatattaacttgcgt
ccctactattccgaaggctccaaaaccctaggctttgaagtagcagaacaactcggatgg
aaactgccggaccatatcgttgcgcctttagcctcgggttctctatataccaaaatttac
aaaggcttccaagaattcgtcaaagtcggattagtggatgaaaaacccgtgcgtttcagt
ggggcacaagcagaaggctgttctccgatcgccaaagccttcagcgaaaaccgcgatttt
gtctccccggttaaacccaataccattgcgaaatctattgcgattggaaatccggctgat
ggcgtttatgccctagaaatcgcccgcaaaaccggcggacatattgagtcggtcaacgac
agcgaaattatcgaaggcattaaacttttagcagaaaccgaaggcatctttaccgaaacc
gccggcggaaccaccattgctgtcctcaagaaattagtagaagctaaaaaaattgatcct
gaagaaacaacggtagtttatattaccggtaatggactcaaaacccaagaagcggttcaa
ggttacatcggtgaacccttagtcattgatgctaacttagatagctttgagagagcatta
gaacgttctcgcaccctagaacgcctggaatggcaacaagttctagtttag

DBGET integrated database retrieval system