KEGG   Cyanothece sp. PCC 7822: Cyan7822_2343Help
Entry
Cyan7822_2343     CDS       T01310                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cyan7822_2343
Enzymes [BR:cyj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cyan7822_2343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2610827..2611735)
Genome map
AA seq 302 aa AA seqDB search
MLLQTTPAVQQFLGSEAITPYESAKVVILPIPYEATTTFRKGCENGPDAVLEASQQLEAY
DEELQQETCIDVGIYTHAAIADTRSQAISAEEMLQVTRETVSELIADHKFVIAVGGEHAI
TTGVVSAYQQAIDEPFTVIQIDAHGDMRSSFEGSIHNHACVMRRVLEMGLPTLPVGIRSI
CAEEAQLIREKQIPVVWAREIAAQPDWIEKALAQITTKKVFITIDVDGIDPSLIPGVGTP
EPGGMGWYDVLHFLKRVFQTHQVIGCDVMELAPVRDSVVSEFTTAKLIYKLIGYQALSQN
WY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcttttacaaactactcctgctgtacaacaatttttaggctctgaagccattacccct
tacgagtcagcaaaagttgtcatattacccataccctacgaagccaccaccacctttcgc
aaaggatgtgaaaatgggccagatgctgtcttagaagcctcccaacaactagaagcttat
gacgaagaattacagcaagaaacctgtattgatgtgggaatttatactcatgctgccata
gctgatactcgctctcaagcaatctcggctgaagaaatgttacaagtcacccgcgaaacg
gtttctgagttaatagccgatcataaatttgtgattgctgtcgggggagaacacgccatc
accacaggagtcgtgagtgcttatcaacaggcaatcgatgaaccctttactgtcattcaa
atcgatgctcatggggatatgcgctcgagttttgaaggttccatccacaatcatgcttgt
gtgatgagacgagtattagaaatgggtttaccgactttaccggtaggaattcgcagtatt
tgtgcagaagaagctcaattaattcgagaaaaacaaattccggtggtttgggctagagaa
atcgcggctcaaccggattggattgaaaaagcactcgctcagattacgacaaaaaaagtc
tttattaccattgatgtagatggcattgatcccagtttgatcccaggggtgggaactcct
gaacctggcggtatgggatggtacgatgtcctgcacttcctcaaacgagtttttcaaact
catcaagtgatcggctgtgatgtgatggaattagcccctgtaagagattcagtggtttcc
gagtttactaccgccaaattaatctataaattaattggatatcaagccctgagccaaaat
tggtattaa

DBGET integrated database retrieval system