KEGG   Cyanothece sp. PCC 7822: Cyan7822_2350Help
Entry
Cyan7822_2350     CDS       T01310                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan7822_2350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7822_2350
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7822_2350
Enzymes [BR:cyj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cyan7822_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2616619..2617413)
Genome map
AA seq 264 aa AA seqDB search
MTSVSDCFKALRARNQCAFIPFITAGDPDLETTAKALQVLAKSGADLIELGVPYSDPLAD
GPVIQAAATRALNRGVKLEDVLGIVEQFSKENSTPIILFTYYNPIFYRGVESFLETIAQA
GVKGLVVPDLPLEEAESLLKPASKIGIEVTLLVAPTSPIERIQAIAAQSQGFIYLVSVTG
VTGVRSQIATRVEDLLSSLRAVTDKPIGVGFGISTREQALQAKQWGADAVIAGSAIVKRL
AEGTPAQGLKSIEEFCHNLKQALV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggtttctgactgttttaaagctctgcgcgctcgcaaccaatgcgcctttatt
ccttttatcactgccggagatccggatttagaaacgacagcaaaagcgttacaggttttg
gccaaatcgggcgcagacctgattgaattaggcgttccttactcagatcccctagcagat
ggcccagttatccaagcggcagctacccgcgcgttaaaccgaggggtaaagctagaagat
gtattagggattgttgaacagttctcaaaagaaaattccaccccgattattctctttact
tactataatccgatcttttatcggggagtagagtcttttctggagaccatcgcccaagca
ggggttaaaggcttagtcgttccggatttacccctagaagaagctgaaagcttactcaaa
cccgcctcgaaaatcgggattgaagtgactttgttagtagctcccaccagtcccattgag
agaattcaagcaatagcggctcaatctcaagggtttatttatttggtcagcgtaacaggg
gtgaccggagtccgctcccaaattgctacccgagtagaagatttattatcctctttacgc
gctgtaaccgataaaccgattggtgtgggttttggcatttctacccgcgaacaggcgcta
caggctaaacaatggggcgcagatgcggttattgctggtagtgccattgttaagcggctg
gccgaaggaacacccgcacaaggattaaaatcgatcgaagaattttgtcataatctaaaa
caagcacttgtttag

  All links  
No link information was found.   
DBGET integrated database retrieval system