KEGG   Cyanothece sp. PCC 7822: Cyan7822_2399Help
Entry
Cyan7822_2399     CDS       T01310                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00260  Glycine, serine and threonine metabolism
cyj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01130  Biosynthesis of antibiotics
cyj01230  Biosynthesis of amino acids
Module
cyj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7822_2399
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7822_2399
Enzymes [BR:cyj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cyan7822_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ADN14374
JGI: Cyan7822_2399
UniProt: E0UFZ1
Position
complement(2665420..2666667)
Genome map
AA seq 415 aa AA seqDB search
MISIINNENTTFQTKQRPDHLGRFGKFGGKYVPETLMPALDELETAFNQYKNDPDFQNEL
QQLLQDYVGRPSPLYFAERLTEYYKKPDGTGAQIYLKREDLNHTGAHKINNALAQVLLAK
RMGKRRIIAETGAGQHGVATATACARFGLECVVYMGIHDMERQALNVFRMKLMGATVSPV
SAGTGTLKDATSEAIRDWVTNVENTHYILGSVAGPHPYPMLVRDFHAIIGQETRAQSAAK
WGGLPDILLACVGGGSNAIGLFHEFVNEPTVRLIGIEAAGEGVDSAKHAATLTRGRVGVL
HGAMSYLLQDEDGQVIEAHSISAGLDYPGVGPEHSYLKEIQRAEYYSVTDEQALAAFERV
SRLEGIIPALETAHAFAYLETLCPQLEGSPRLVINCSGRGDKDVQTVANLFKIKN
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgattagcatcatcaataacgaaaacaccacttttcaaacaaaacagcgacccgatcat
ctaggacgatttggaaaatttggcggcaaatacgtcccagaaaccttaatgcccgcctta
gacgaactagaaaccgccttcaatcaatacaaaaacgatcccgactttcaaaacgaacta
caacaactcttacaagactacgttggacggcccagccctttatactttgccgaacgtcta
accgaatactataaaaaacccgacggcacaggggcccaaatatacctcaagcgggaagac
ttaaaccataccggtgcccacaaaattaacaacgcattagcccaagtcctactcgctaaa
cgcatggggaaacggcgtattattgccgaaactggagccggacaacatggagtagccaca
gctactgcttgcgctcgttttggtttagaatgcgtggtctatatgggcattcatgacatg
gaacggcaagccctcaatgtgtttcgcatgaaattaatgggagctacagtctctccggta
tcggcaggtacaggaaccctcaaagatgccacttctgaagcgatccgagattgggtaacg
aatgtcgaaaatacccactatattttaggttctgttgccggacctcatccctaccccatg
ttagttcgggacttccacgctattattggccaagaaactcgcgctcaaagtgcggcaaaa
tgggggggtttaccggatatccttctcgcttgcgtgggtggcggttctaatgccatcgga
ttgtttcatgaatttgtgaatgagcctacagtacgattgatcggtattgaggcagcaggg
gaaggcgttgactcagcaaaacacgcggcgacgctaacgcgaggaagagttggggtttta
catggagccatgagctacctattacaagatgaagatgggcaagtgatagaagctcattct
attagtgctgggctagattatcccggagtcgggcccgaacatagttatttaaaagaaatt
caacgggcggaatattacagtgttactgatgagcaggcattagccgcctttgagagggtt
tctcgcttagagggcattataccggctctagaaacggctcatgcttttgcttatttagaa
accctttgcccgcaactcgaaggcagtccccgccttgtgattaactgttctggacggggt
gataaagacgtgcaaactgtcgctaatctattcaaaataaaaaattaa

DBGET integrated database retrieval system