KEGG   Cyanothece sp. PCC 7822: Cyan7822_2400Help
Entry
Cyan7822_2400     CDS       T01310                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00260  Glycine, serine and threonine metabolism
cyj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01130  Biosynthesis of antibiotics
cyj01230  Biosynthesis of amino acids
Module
cyj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7822_2400
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7822_2400
Enzymes [BR:cyj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cyan7822_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB TMP-TENI IGPS Ribul_P_3_epim NanE FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: ADN14375
JGI: Cyan7822_2400
UniProt: E0UFZ2
Position
complement(2666734..2667555)
Genome map
AA seq 273 aa AA seqDB search
MNNSIANRFKLLKSRNQCAMIPFITAGDPDLETTAAALKILDQNGADFIELGIPYSDPLA
DGPIIQAAATRALQKGTQLEQVLELVNAVSPSLTAPIILFTYYNPILNRGIKTFLAQIAA
VGVKGLVIPDLPVDEASEILEIAATYGIEIILLVAPTSSRARIETIAQKSQGFIYLVSVT
GVTGMRSQIQARVKNLLSEIRDITDKPIGIGFGISNTEQAKELKKWGADAIIVGSAIVKR
LANNNPSEGLQEIEKFVRELKTAITDESLVVSH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaataactctattgccaatcgttttaaactcttaaaatcccgtaatcagtgtgcgatg
atcccctttatcaccgccggcgaccctgatttagaaaccaccgcagccgcactaaaaata
ttagatcaaaacggggctgacttcatagaattaggaataccctatagcgatcctctggca
gacggacccattattcaagcggcagcaacccgtgcattacaaaaaggcacacaactagaa
caagttctagaattagtcaacgccgtcagtcccagcttaacagcccccattattttattc
acctactacaaccccattttaaatcgaggaatcaaaacctttctagctcaaatcgccgca
gtaggagtcaaaggattagtgatacccgatctccctgtcgatgaagcatcagaaattctt
gaaatcgctgccacctacggcatagaaatcatcttgctagtggctcccacctcttcaaga
gccagaatagaaaccatcgcccaaaaatcccaaggattcatctacctcgtcagcgtaacc
ggagtaaccggaatgcgctcacaaatccaagcaagagtcaaaaatttactatctgaaatt
agagacattaccgacaaacccatcggtataggcttcggaatatccaatactgaacaagca
aaagaattaaaaaaatggggtgccgatgcgattattgtcggtagcgccattgtcaaacgt
ttagcaaacaataacccaagcgaaggactccaagagatagaaaaatttgttcgtgaactc
aaaacagcaataactgatgagtcattagttgttagtcattag

DBGET integrated database retrieval system