KEGG   Cyanothece sp. PCC 7822: Cyan7822_2400Help
Entry
Cyan7822_2400     CDS       T01310                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan7822_2400
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7822_2400
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7822_2400
Enzymes [BR:cyj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cyan7822_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2666734..2667555)
Genome map
AA seq 273 aa AA seqDB search
MNNSIANRFKLLKSRNQCAMIPFITAGDPDLETTAAALKILDQNGADFIELGIPYSDPLA
DGPIIQAAATRALQKGTQLEQVLELVNAVSPSLTAPIILFTYYNPILNRGIKTFLAQIAA
VGVKGLVIPDLPVDEASEILEIAATYGIEIILLVAPTSSRARIETIAQKSQGFIYLVSVT
GVTGMRSQIQARVKNLLSEIRDITDKPIGIGFGISNTEQAKELKKWGADAIIVGSAIVKR
LANNNPSEGLQEIEKFVRELKTAITDESLVVSH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaataactctattgccaatcgttttaaactcttaaaatcccgtaatcagtgtgcgatg
atcccctttatcaccgccggcgaccctgatttagaaaccaccgcagccgcactaaaaata
ttagatcaaaacggggctgacttcatagaattaggaataccctatagcgatcctctggca
gacggacccattattcaagcggcagcaacccgtgcattacaaaaaggcacacaactagaa
caagttctagaattagtcaacgccgtcagtcccagcttaacagcccccattattttattc
acctactacaaccccattttaaatcgaggaatcaaaacctttctagctcaaatcgccgca
gtaggagtcaaaggattagtgatacccgatctccctgtcgatgaagcatcagaaattctt
gaaatcgctgccacctacggcatagaaatcatcttgctagtggctcccacctcttcaaga
gccagaatagaaaccatcgcccaaaaatcccaaggattcatctacctcgtcagcgtaacc
ggagtaaccggaatgcgctcacaaatccaagcaagagtcaaaaatttactatctgaaatt
agagacattaccgacaaacccatcggtataggcttcggaatatccaatactgaacaagca
aaagaattaaaaaaatggggtgccgatgcgattattgtcggtagcgccattgtcaaacgt
ttagcaaacaataacccaagcgaaggactccaagagatagaaaaatttgttcgtgaactc
aaaacagcaataactgatgagtcattagttgttagtcattag

DBGET integrated database retrieval system