KEGG   Cyanothece sp. PCC 7822: Cyan7822_2401Help
Entry
Cyan7822_2401     CDS       T01310                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01130  Biosynthesis of antibiotics
cyj01230  Biosynthesis of amino acids
Module
cyj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7822_2401
Enzymes [BR:cyj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cyan7822_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth IMPDH NMO
Motif
Other DBs
NCBI-ProteinID: ADN14376
JGI: Cyan7822_2401
UniProt: E0UFZ3
Position
complement(2667595..2668443)
Genome map
AA seq 282 aa AA seqDB search
MQAFSPLSSQTSPQKTPNILAKIVRQKKQEIEQLYSQHSLKELESSIHQYSLPKNFRLAL
HQGVMQPSLIAEVKKASPSKGIIREDFDPVEIATAYERNQAACLSVLTDEKFFCGSFENL
LRVRQNVSLPLLCKEFIIDPIQIYWARKHGADAILLIAAILSDQQIQSFLKLIHRLGMEA
LIEVHTLGELDRVLKLSEVRLIGINNRNLEDFSVDLKTTQQLIAQRKEQIENLGITLVSE
SGIHTKSDLDFVLACGADAVLIGESLVKQIDIKTAIKNLYSH
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctttttcccccttatcatctcaaacatccccccaaaaaacgcctaatatatta
gccaaaatagtccgacaaaaaaagcaggaaattgaacaactgtactctcaacattcctta
aaagaattagagtcatctattcatcaatattctctgcccaaaaatttccgacttgccctc
caccaaggggtcatgcaacctagcttaattgccgaagtcaaaaaagcttccccaagtaaa
ggcatcatacgagaagattttgaccctgtagaaattgccacagcttatgaacgaaaccaa
gccgcttgtttatcagtgctaaccgatgaaaaattcttctgtggaagttttgaaaacttg
ctcagagtgcggcaaaatgtatcattacctttactgtgtaaagaattcatcattgatccc
atccaaatatattgggcaagaaagcatggtgctgatgcaatattgctaattgcggcgatt
ttatcagaccaacaaattcaatcttttctgaaactgattcatcgtttaggaatggaagcc
ctaattgaagtacatactttaggcgaattagatcgcgtcttaaagctttctgaagtacga
ttaataggaattaacaatcgtaacttagaggatttttctgtagatcttaaaaccacacag
caacttattgctcaaagaaaagaacagatcgaaaatttaggcataacccttgtaagtgag
tcgggtatccatacaaagtctgatttggattttgtcctagcttgtggagcggatgctgtt
ttaatcggagaatctttagtcaaacagattgatatcaaaacagccattaaaaacctttat
agtcattag

DBGET integrated database retrieval system