KEGG   Cyanothece sp. PCC 7822: Cyan7822_2401Help
Entry
Cyan7822_2401     CDS       T01310                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan7822_2401
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7822_2401
Enzymes [BR:cyj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cyan7822_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2667595..2668443)
Genome map
AA seq 282 aa AA seqDB search
MQAFSPLSSQTSPQKTPNILAKIVRQKKQEIEQLYSQHSLKELESSIHQYSLPKNFRLAL
HQGVMQPSLIAEVKKASPSKGIIREDFDPVEIATAYERNQAACLSVLTDEKFFCGSFENL
LRVRQNVSLPLLCKEFIIDPIQIYWARKHGADAILLIAAILSDQQIQSFLKLIHRLGMEA
LIEVHTLGELDRVLKLSEVRLIGINNRNLEDFSVDLKTTQQLIAQRKEQIENLGITLVSE
SGIHTKSDLDFVLACGADAVLIGESLVKQIDIKTAIKNLYSH
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctttttcccccttatcatctcaaacatccccccaaaaaacgcctaatatatta
gccaaaatagtccgacaaaaaaagcaggaaattgaacaactgtactctcaacattcctta
aaagaattagagtcatctattcatcaatattctctgcccaaaaatttccgacttgccctc
caccaaggggtcatgcaacctagcttaattgccgaagtcaaaaaagcttccccaagtaaa
ggcatcatacgagaagattttgaccctgtagaaattgccacagcttatgaacgaaaccaa
gccgcttgtttatcagtgctaaccgatgaaaaattcttctgtggaagttttgaaaacttg
ctcagagtgcggcaaaatgtatcattacctttactgtgtaaagaattcatcattgatccc
atccaaatatattgggcaagaaagcatggtgctgatgcaatattgctaattgcggcgatt
ttatcagaccaacaaattcaatcttttctgaaactgattcatcgtttaggaatggaagcc
ctaattgaagtacatactttaggcgaattagatcgcgtcttaaagctttctgaagtacga
ttaataggaattaacaatcgtaacttagaggatttttctgtagatcttaaaaccacacag
caacttattgctcaaagaaaagaacagatcgaaaatttaggcataacccttgtaagtgag
tcgggtatccatacaaagtctgatttggattttgtcctagcttgtggagcggatgctgtt
ttaatcggagaatctttagtcaaacagattgatatcaaaacagccattaaaaacctttat
agtcattag

DBGET integrated database retrieval system