KEGG   Cyanothece sp. PCC 7822: Cyan7822_2460Help
Entry
Cyan7822_2460     CDS       T01310                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_2460
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyan7822_2460
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan7822_2460
Enzymes [BR:cyj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Cyan7822_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2727968..2729584
Genome map
AA seq 538 aa AA seqDB search
MVLTATNKTPLTQGVRIRGRMLDKYAEILSDSALNFLAMLQRRFGARRSHLLELRQNIQQ
QIHAGWMPEFSEETEDIRNSQWQIAPIPVDLQDRRVEITGPVDRKMIINALNSGANAYMA
DFEDSSSPTWDNMVSGQLNLRDAVVGSIEYIDPTKNKVYRLKEKTAVLLVRPRGWHLLEE
HLLIDDQPISASLFDFGLYFFHNAEKLLLKGTGPYFYLPKLENRQEAALWNEVFIAAQEA
LGLPVGTIKATVLIETILAAFEMDEILYHLKDHIVALNCGRWDYIFSFIKKLSFCPQFVL
PERSVVTMTRHFMRSYSLLTIQTCHRRGALAMGGMAAQIPIKSDPQANELALAKVRADKE
REASDGHDGTWVAHPALVPLAKEVFDSKIKGANQLSVLREDVQVTAKDLLEVPDGSITES
GLRNNIRVGILYISSWLDGIGCVPLYNLMEDAATAEICRAQIWQWLHHHAKLEDGRNIDQ
ALFQSLLNEETVALRQENQNQSPNFNKAVELFVQLVMADEFEDFLTLCAYRKIVEFDN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggttcttactgctacaaacaaaacaccattaactcaaggggttcgcattcgtggccgg
atgttggacaaatatgctgagattctttcagattctgcccttaactttctggccatgtta
cagcgccgctttggcgctcgtcgttcccatcttttggaactcagacaaaacatccaacaa
caaattcatgccggatggatgcctgagttttctgaagaaactgaagacatccgtaacagc
cagtggcaaattgctcctatccctgtagacttacaagaccggcgcgttgaaattacaggt
ccagtagatcggaaaatgattatcaacgctcttaactccggtgccaatgcctatatggct
gactttgaagattccagcagtcccacttgggataatatggtatcgggtcaactgaacttg
cgagatgccgttgtcggcagcatcgaatatatcgatccgacaaaaaataaagtctatcgg
ctcaaggaaaaaacggcagttctcctggttcgtccccgaggctggcatcttttagaagaa
catcttttaatagacgatcaacccatctcagcatcgctatttgatttcgggctttatttc
tttcataacgccgaaaaattactccttaaaggcactggtccctatttttacttacccaag
ctagaaaaccgtcaagaggctgccctctggaatgaggtttttatcgctgcccaagaagcc
ctaggcttacctgtgggaaccattaaggcaacagttttaatagaaaccattctcgccgcc
tttgagatggatgaaatcctctatcatctcaaagatcacattgtcgctctcaattgcggt
cgctgggattatatctttagctttatcaaaaaattgagcttctgtccccaatttgtgcta
ccagagcgctcggttgtcaccatgacgcgccattttatgcgttcctatagcttactcacc
attcaaacttgtcatcgtcgcggtgctttggcgatgggagggatggcggcacaaattccc
attaaatctgatccacaagctaatgaacttgctctggctaaagtccgtgctgataaagaa
cgcgaagcaagcgatggtcatgacggcacttgggtcgctcatcctgctttagttcccctg
gctaaagaagtatttgacagtaaaatcaaaggagctaatcaactgtcggtactgcgcgaa
gatgtacaggtaaccgcaaaagatttattagaagtccctgacggttccatcaccgaatcc
ggactcagaaacaatattcgcgtgggaattttgtatataagttcttggttagatggtatc
ggctgcgttcccttatataatttaatggaagatgcagctaccgccgaaatctgtcgggca
caaatttggcaatggttacaccatcatgctaaattagaagacggacgcaatatcgatcaa
gccctgttccagtctcttcttaacgaggaaacagtcgccttgcgtcaagagaatcaaaac
cagtcccctaactttaacaaagctgtggaattattcgtacagctagttatggctgatgaa
tttgaagactttttaaccctgtgcgcctatcggaaaattgtcgaatttgacaattaa

DBGET integrated database retrieval system