KEGG   Cyanothece sp. PCC 7822: Cyan7822_2460Help
Entry
Cyan7822_2460     CDS       T01310                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_2460
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyan7822_2460
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan7822_2460
Enzymes [BR:cyj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Cyan7822_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2727968..2729584
Genome map
AA seq 538 aa AA seqDB search
MVLTATNKTPLTQGVRIRGRMLDKYAEILSDSALNFLAMLQRRFGARRSHLLELRQNIQQ
QIHAGWMPEFSEETEDIRNSQWQIAPIPVDLQDRRVEITGPVDRKMIINALNSGANAYMA
DFEDSSSPTWDNMVSGQLNLRDAVVGSIEYIDPTKNKVYRLKEKTAVLLVRPRGWHLLEE
HLLIDDQPISASLFDFGLYFFHNAEKLLLKGTGPYFYLPKLENRQEAALWNEVFIAAQEA
LGLPVGTIKATVLIETILAAFEMDEILYHLKDHIVALNCGRWDYIFSFIKKLSFCPQFVL
PERSVVTMTRHFMRSYSLLTIQTCHRRGALAMGGMAAQIPIKSDPQANELALAKVRADKE
REASDGHDGTWVAHPALVPLAKEVFDSKIKGANQLSVLREDVQVTAKDLLEVPDGSITES
GLRNNIRVGILYISSWLDGIGCVPLYNLMEDAATAEICRAQIWQWLHHHAKLEDGRNIDQ
ALFQSLLNEETVALRQENQNQSPNFNKAVELFVQLVMADEFEDFLTLCAYRKIVEFDN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggttcttactgctacaaacaaaacaccattaactcaaggggttcgcattcgtggccgg
atgttggacaaatatgctgagattctttcagattctgcccttaactttctggccatgtta
cagcgccgctttggcgctcgtcgttcccatcttttggaactcagacaaaacatccaacaa
caaattcatgccggatggatgcctgagttttctgaagaaactgaagacatccgtaacagc
cagtggcaaattgctcctatccctgtagacttacaagaccggcgcgttgaaattacaggt
ccagtagatcggaaaatgattatcaacgctcttaactccggtgccaatgcctatatggct
gactttgaagattccagcagtcccacttgggataatatggtatcgggtcaactgaacttg
cgagatgccgttgtcggcagcatcgaatatatcgatccgacaaaaaataaagtctatcgg
ctcaaggaaaaaacggcagttctcctggttcgtccccgaggctggcatcttttagaagaa
catcttttaatagacgatcaacccatctcagcatcgctatttgatttcgggctttatttc
tttcataacgccgaaaaattactccttaaaggcactggtccctatttttacttacccaag
ctagaaaaccgtcaagaggctgccctctggaatgaggtttttatcgctgcccaagaagcc
ctaggcttacctgtgggaaccattaaggcaacagttttaatagaaaccattctcgccgcc
tttgagatggatgaaatcctctatcatctcaaagatcacattgtcgctctcaattgcggt
cgctgggattatatctttagctttatcaaaaaattgagcttctgtccccaatttgtgcta
ccagagcgctcggttgtcaccatgacgcgccattttatgcgttcctatagcttactcacc
attcaaacttgtcatcgtcgcggtgctttggcgatgggagggatggcggcacaaattccc
attaaatctgatccacaagctaatgaacttgctctggctaaagtccgtgctgataaagaa
cgcgaagcaagcgatggtcatgacggcacttgggtcgctcatcctgctttagttcccctg
gctaaagaagtatttgacagtaaaatcaaaggagctaatcaactgtcggtactgcgcgaa
gatgtacaggtaaccgcaaaagatttattagaagtccctgacggttccatcaccgaatcc
ggactcagaaacaatattcgcgtgggaattttgtatataagttcttggttagatggtatc
ggctgcgttcccttatataatttaatggaagatgcagctaccgccgaaatctgtcgggca
caaatttggcaatggttacaccatcatgctaaattagaagacggacgcaatatcgatcaa
gccctgttccagtctcttcttaacgaggaaacagtcgccttgcgtcaagagaatcaaaac
cagtcccctaactttaacaaagctgtggaattattcgtacagctagttatggctgatgaa
tttgaagactttttaaccctgtgcgcctatcggaaaattgtcgaatttgacaattaa

DBGET integrated database retrieval system