KEGG   Cyanothece sp. PCC 7822: Cyan7822_2460Help
Entry
Cyan7822_2460     CDS       T01310                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00620  Pyruvate metabolism
cyj00630  Glyoxylate and dicarboxylate metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01120  Microbial metabolism in diverse environments
cyj01200  Carbon metabolism
Module
cyj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyan7822_2460
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan7822_2460
Enzymes [BR:cyj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Cyan7822_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADN14433
JGI: Cyan7822_2460
UniProt: E0UGV2
Position
2727968..2729584
Genome map
AA seq 538 aa AA seqDB search
MVLTATNKTPLTQGVRIRGRMLDKYAEILSDSALNFLAMLQRRFGARRSHLLELRQNIQQ
QIHAGWMPEFSEETEDIRNSQWQIAPIPVDLQDRRVEITGPVDRKMIINALNSGANAYMA
DFEDSSSPTWDNMVSGQLNLRDAVVGSIEYIDPTKNKVYRLKEKTAVLLVRPRGWHLLEE
HLLIDDQPISASLFDFGLYFFHNAEKLLLKGTGPYFYLPKLENRQEAALWNEVFIAAQEA
LGLPVGTIKATVLIETILAAFEMDEILYHLKDHIVALNCGRWDYIFSFIKKLSFCPQFVL
PERSVVTMTRHFMRSYSLLTIQTCHRRGALAMGGMAAQIPIKSDPQANELALAKVRADKE
REASDGHDGTWVAHPALVPLAKEVFDSKIKGANQLSVLREDVQVTAKDLLEVPDGSITES
GLRNNIRVGILYISSWLDGIGCVPLYNLMEDAATAEICRAQIWQWLHHHAKLEDGRNIDQ
ALFQSLLNEETVALRQENQNQSPNFNKAVELFVQLVMADEFEDFLTLCAYRKIVEFDN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggttcttactgctacaaacaaaacaccattaactcaaggggttcgcattcgtggccgg
atgttggacaaatatgctgagattctttcagattctgcccttaactttctggccatgtta
cagcgccgctttggcgctcgtcgttcccatcttttggaactcagacaaaacatccaacaa
caaattcatgccggatggatgcctgagttttctgaagaaactgaagacatccgtaacagc
cagtggcaaattgctcctatccctgtagacttacaagaccggcgcgttgaaattacaggt
ccagtagatcggaaaatgattatcaacgctcttaactccggtgccaatgcctatatggct
gactttgaagattccagcagtcccacttgggataatatggtatcgggtcaactgaacttg
cgagatgccgttgtcggcagcatcgaatatatcgatccgacaaaaaataaagtctatcgg
ctcaaggaaaaaacggcagttctcctggttcgtccccgaggctggcatcttttagaagaa
catcttttaatagacgatcaacccatctcagcatcgctatttgatttcgggctttatttc
tttcataacgccgaaaaattactccttaaaggcactggtccctatttttacttacccaag
ctagaaaaccgtcaagaggctgccctctggaatgaggtttttatcgctgcccaagaagcc
ctaggcttacctgtgggaaccattaaggcaacagttttaatagaaaccattctcgccgcc
tttgagatggatgaaatcctctatcatctcaaagatcacattgtcgctctcaattgcggt
cgctgggattatatctttagctttatcaaaaaattgagcttctgtccccaatttgtgcta
ccagagcgctcggttgtcaccatgacgcgccattttatgcgttcctatagcttactcacc
attcaaacttgtcatcgtcgcggtgctttggcgatgggagggatggcggcacaaattccc
attaaatctgatccacaagctaatgaacttgctctggctaaagtccgtgctgataaagaa
cgcgaagcaagcgatggtcatgacggcacttgggtcgctcatcctgctttagttcccctg
gctaaagaagtatttgacagtaaaatcaaaggagctaatcaactgtcggtactgcgcgaa
gatgtacaggtaaccgcaaaagatttattagaagtccctgacggttccatcaccgaatcc
ggactcagaaacaatattcgcgtgggaattttgtatataagttcttggttagatggtatc
ggctgcgttcccttatataatttaatggaagatgcagctaccgccgaaatctgtcgggca
caaatttggcaatggttacaccatcatgctaaattagaagacggacgcaatatcgatcaa
gccctgttccagtctcttcttaacgaggaaacagtcgccttgcgtcaagagaatcaaaac
cagtcccctaactttaacaaagctgtggaattattcgtacagctagttatggctgatgaa
tttgaagactttttaaccctgtgcgcctatcggaaaattgtcgaatttgacaattaa

DBGET integrated database retrieval system