KEGG   Cyanothece sp. PCC 7822: Cyan7822_2461Help
Entry
Cyan7822_2461     CDS       T01310                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_2461
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan7822_2461
Enzymes [BR:cyj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Cyan7822_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2729692..2731170
Genome map
AA seq 492 aa AA seqDB search
MTSLTFEQLVSHVPQGRFNGIERNYTPEDVQKLRGSIKIQYTLAELGANRLWELLHKEDY
IHALGAVTGNQAMQMVRAGLKAIYLSGWQVAADANLAGTMYPDQSLYPSNSGPELCRRIN
RTFQRADQINHSEGRNGVHWFAPIVADAEAGFGGPLNSFEIMKAYIEAGAAAVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLIVARTDAESAKLITSDIDERDR
PFITGERTPEGFYRLREGSGLDHCIARGLSYAPYADLLWWETSKPNLEEARRFAEAIHRE
YPGKLLAYNCSPSFNWRTNLDDETIIKFQKELGAMGYKFQFVTLAGFHCLNHSMFELARH
YAHSGMEAYAQLQEAEFLSEEQGYTATRHQREVGTGYFDAVSVAISGGQSSTTAMSASTE
VEQFQGHEDHHQGMTEPENVPPVWYEIVNAHIGSGTSRHPEEVKAFEAFKEARYARIKEA
YREIEEIAHLDD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactgacctttgaacaattagtttcccatgttccccaaggccgttttaacgga
attgagcgaaactatacccccgaggatgtacaaaaattacgcggctctatcaaaattcaa
tatactttagccgaacttggagcaaaccggctctgggaacttttacataaagaagattat
attcatgctctgggcgcagtgaccggcaaccaagcgatgcaaatggtacgcgccggactc
aaagccatttatttatcaggttggcaagtggccgccgatgctaatctcgccggtaccatg
tatccggaccaaagtctttatccctccaacagtggccctgaattatgccgccgcattaac
cgcacctttcaacgggccgatcagatcaaccactcagaaggacgcaatggggttcactgg
tttgcgcccattgtcgctgatgctgaagccggttttggcggccccctcaatagctttgaa
atcatgaaagcttatatcgaagccggggcggctgcggttcattatgaagatcaactcgct
tctgaaaagaaatgcggacatttaggtggcaaagttttaattcctacggcggctcatatt
cgtaaccttaatgctgctcgtcttgctgctgatgtcatgggcactcctaccttaattgtg
gctcgtaccgatgctgaaagcgctaaattaatcaccagcgatattgatgaacgcgatcgc
cccttcatcaccggtgagcgtactcctgaaggcttctaccgcttacgggaaggttcaggt
ttagaccattgtattgctcggggactttcttatgccccctatgctgacttactctggtgg
gaaacctccaaacccaacctcgaagaagcccgccgcttcgccgaagccattcatagagag
tatcctggtaaactcctcgcttataactgttctccttcctttaactggagaaccaattta
gacgatgaaaccatcatcaaattccaaaaagaactaggcgcaatggggtataaattccag
tttgtcaccttagccggcttccactgcctcaaccacagtatgtttgaattagcgcgtcat
tatgctcacagtggtatggaagcttatgctcaactgcaagaagccgaattcttgagcgag
gaacagggctataccgctactcgtcatcaacgcgaggtcggcaccggttactttgatgcc
gtttccgttgctatctccggcggacaatcttccaccaccgctatgtcagcatctactgag
gttgagcagttccaaggccatgaagatcaccaccagggaatgacagaaccggaaaatgtt
cctcctgtttggtatgaaattgtcaacgctcacattggtagcggaacctcacgccatcct
gaagaagtaaaagcgtttgaagctttcaaagaagcacgttatgcccgcataaaagaagct
tatcgggaaatagaggaaattgctcaccttgatgattaa

DBGET integrated database retrieval system