KEGG   Cyanothece sp. PCC 7822: Cyan7822_2642Help
Entry
Cyan7822_2642     CDS       T01310                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cyan7822_2642
Enzymes [BR:cyj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Cyan7822_2642
Transfer RNA biogenesis [BR:cyj03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Cyan7822_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2942174..2943079)
Genome map
AA seq 301 aa AA seqDB search
MSMITITNLEQTEKLAEIAEVLRSIGWGASDILRAYYRGEAGYGNLNVQEDKKDGPVTAA
DLATNHYILAKLQEVFAPEEYGYLSEETHTGTDPLPQDWVWVIDPLDGTRDFIDKTGEYA
IHIALTYQGRPVVALVAIPEANKIYYATKGGGTFVEDRSGEIKPSKVSQRNQIEELYLVA
SRTHRDERFQKLLERMPFKARNYVGSVGCKISTILEQQSDVYISLSGKSAPKDWDFAAPE
LILTEAGGKFTHFSGEPLIYNKGDVRQWGGLMASHGVCHQELCQLATSILADIDGLSLPK
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgatcacaataacaaaccttgagcaaacagaaaaattagcagaaatcgccgag
gttcttcgttcaattggatggggagcatcagatattcttcgcgcctattatcggggtgag
gcggggtatggaaatttgaatgtacaggaagataaaaaagatgggccggtaacggcggct
gatctggccacaaatcattatattttagcaaaacttcaagaggtttttgcccccgaagaa
tacggctacctcagtgaagaaactcatacagggactgatcccctgcctcaagattgggtt
tgggtgatagatccgcttgatgggactcgggattttattgataagactggagaatatgcc
attcatattgctttaacttatcaaggtcggcctgtggtggctttggtcgctatacctgaa
gccaataaaatttattatgccactaaaggcggtgggacttttgtcgaagatcgctctggg
gaaattaaaccctcaaaagtttcacaacggaatcaaatagaggagttatacttagtggct
agtcgtacccaccgagatgaacgctttcaaaaattgttagaaagaatgccttttaaagca
cgcaactatgtggggagtgtgggctgtaaaatttccaccatcttagagcaacaatctgat
gtttatatttctctgtcgggtaaatctgcacctaaagattgggattttgcggctcccgag
ttaattttaaccgaagccggcggaaaatttactcattttagtggagagcctttgatttat
aacaagggcgatgtcagacaatggggtgggttaatggctagtcatggtgtttgtcatcaa
gagttatgtcagttagcgacctcaattttggcagatattgatgggctatctttgccgaaa
aaataa

DBGET integrated database retrieval system