KEGG   Cyanothece sp. PCC 7822: Cyan7822_3033Help
Entry
Cyan7822_3033     CDS       T01310                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cyj01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyj01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyj00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cyj00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cyj00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cyj00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cyj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3360202..3361410)
Genome map
AA seq 402 aa AA seqDB search
MTKKKRVGILTSGGDCPGLNAIIRAVVKAANRKNWEVYGLPYGTDGFIHLAKGIRTPEEL
KLGEHGYDLPGHLQGLDILQFLSGSILGSLSKGNPEDPEVAQTILEGYKLLQLDALIAIG
GDGSLDIIYQLAQQGNWNFVGIPKTIDNDVPFTERAVGFDTAVDTVTNALYNLTFTAASH
ERVMIAQVMGRDAGHLALHAGIAGGADVILIPELAPHLSDMVVDGCCRQIAHIRASGRQF
ALIVIAEGVRNDHNEKEKYIGDYLAQRIEQHSQKLCETGHKEFCPLSAIDVRVTVLGHLQ
RSGTPSSSDRLIGTAFGIKAIELIEQEAYSRLVVWQHGGVYSQPLDQVIAVIRQCHRENR
CAYPVDPDGFMVQTARSLGIYLGDHNLPLDHIDSKPTVELSI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaaaacgagttggtatattaacaagtggtggcgattgtccagggttaaat
gccattattagggctgtggttaaggcggctaatcggaaaaattgggaagtttatggcttg
ccctacggaaccgatggatttattcacctagccaaaggaattcgcaccccagaagaattg
aaactgggtgaacatggttatgatctgccaggacatttacaggggttagatattcttcag
tttctcagtggcagtattttgggatcgctgagtaagggaaatcctgaagatccagaagtc
gctcagacaattttggaaggctataaactattacaattagatgctctgattgccatcggc
ggagacgggagtttagacattatctatcaattagctcaacaaggtaattggaatttcgtc
ggtattcccaaaaccattgataatgatgtcccttttactgaacgcgccgtcggatttgat
acagccgttgacacagtgaccaatgcgttgtataatcttacattcacggcggcttcccat
gaacgagtcatgattgctcaagtgatgggacgtgatgccggacatttagcccttcatgca
ggaattgccggcggggcagatgtgattctgattcccgaattagcacctcatctatcagat
atggttgtggatggctgttgccgccaaatcgctcatattcgcgcatcgggtcgtcagttt
gccctgattgtcattgctgaaggggtgagaaatgatcataacgaaaaagaaaagtatatc
ggggactatttagcccaaagaattgaacagcacagccaaaaattgtgtgaaactggacat
aaagagttctgtcctctgagtgctattgatgtacgggtgacggtcttaggacacttacaa
cgcagtggaactccttccagtagcgatcgcttgattggaacggcttttgggattaaagct
atagaattgattgaacaggaggcttattctcgcctggtagtctggcaacatgggggagtt
tacagccaaccgttggatcaagtgattgctgtgattcggcaatgtcatcgggaaaaccgt
tgcgcctatccagttgatcctgatgggtttatggtacaaacagcaaggtcattgggcatc
tatctaggagatcacaatttgcctttagatcatatcgactctaaacccactgtcgagtta
tcgatctaa

DBGET integrated database retrieval system