KEGG   Cyanothece sp. PCC 7822: Cyan7822_3782Help
Entry
Cyan7822_3782     CDS       T01310                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_3782
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan7822_3782
   00640 Propanoate metabolism
    Cyan7822_3782
   00660 C5-Branched dibasic acid metabolism
    Cyan7822_3782
Enzymes [BR:cyj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cyan7822_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4190862..4192124
Genome map
AA seq 420 aa AA seqDB search
MDLLEYHAKELFDEVGIPVLPSQPIHDTGELKRLQIPYPVVLKSQVRAGGRGKSGGIRFV
ENTIDAIAAARAIFSLPILGEYPEVILAEARYDAQEEFFLAVVLDYQLQRPVLLGSVKGG
MDVEALLEYMQRVVIEEEFSPFYARRLVKKMGIAEGLIESVSTIIEKMYYLFWEKDLDLI
EINPLGVNAQGEVMALDGKISVNDCALDRHPELACLICSKKDYLQGAAEENALRDCETVV
DLHWLEGVDELGNVGIICNSHGLALTTWDLIVQAQGKPNYCLILEEGSDCPSLSQQLELG
LEQMMELSALKAVLVNIVASPEVSETVAQAIANYLQPQLKQQLPQKGEERIIRATGAGSS
RKRLVKTRSQSSKPQQIQWVIRLINGEVQPIQESLSLLPLHWTKTLDDAVNQTISILKSK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggatttacttgaatatcacgctaaagaactgtttgatgaagtcggtatccccgtttta
ccttcccaacccattcatgatacaggagaattaaaacgcctacagattccctacccggtt
gtcctaaaatctcaagtgcgggcaggcggtaggggaaagtcgggaggaattcgctttgta
gaaaatactattgatgctatagccgccgctagagcgatttttagtttacccattttagga
gaatatccagaggtgatcctagccgaagcccgctatgatgctcaagaagaattttttctg
gcagtggttcttgattatcagctacaacgtcctgtgctgttaggctcggttaaaggaggt
atggatgtagaagccttacttgagtatatgcaaagggtggtcatcgaagaagagttttct
cctttttatgctcgtcgtttagtgaaaaaaatgggcattgctgaaggactcattgagtca
gtgagtaccattatcgaaaaaatgtattatttattttgggaaaaagatttagatttaatt
gaaattaatcctttaggcgtgaatgctcaaggggaagtgatggcgcttgatgggaaaatt
tctgtcaatgactgcgccctagatcgtcatcctgagttagcctgtttaatttgttcaaaa
aaagattatctacaaggagcggctgaagaaaacgcgctaagagactgtgaaaccgtcgtg
gatttacactggcttgaaggtgttgatgaactgggaaatgtggggattatttgtaatagt
cacggattggctttaaccacttgggatttaattgttcaggcacaaggaaagccaaattat
tgtttaattttagaagaaggctctgattgtccttcgctctctcaacaactcgagttggga
ttagagcagatgatggaattgtcagctttaaaagccgtgttagtcaatattgttgctagt
cccgaagtgagtgaaacggtagcccaagccatcgctaattaccttcaacctcaactcaaa
cagcaattaccccaaaaaggagaagaacgaattattcgagccactggggccggttcgtct
cgcaaacgattagttaaaactcgctctcaatcctcgaaacctcagcaaattcaatgggta
attcgtctgattaatggagaagttcaaccgattcaagaaagtttatcgctcttgcctctc
cactggacaaaaactttagacgatgctgtcaatcaaactatctctatcttaaaatctaag
taa

DBGET integrated database retrieval system