KEGG   Cyanothece sp. PCC 7822: Cyan7822_4228Help
Entry
Cyan7822_4228     CDS       T01310                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan7822_4228
Enzymes [BR:cyj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cyan7822_4228
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cyan7822_4228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4650042..4651565
Genome map
AA seq 507 aa AA seqDB search
MTSGKVSLIGAGPGSIAYLTLKGQHLLSQAEVLIYDDLVDPQLLQLVPSNCVQLHVGKRG
GSPSTPQDIINLLLVDFCSQGKQVVRLKGGDPFIFGRANPEIGALIAANCHYEVIPGISS
ALAAPLLAGIPLTDKDLSRCFVVLSAHDPDILDWDAIAKIDTIVILMGGRFLEDIIQNLQ
EKGRSPSTPIAIIRHCARPEQQVWIGTLGDIVDQITEESLSPTVMVIGDVVKLRNMTTSP
SLPLSGKTVIVTRAAEQSSKFSDLLQEQGATVIEMPALEITPPSSWEGLDQAIATLKDFH
WLILTSANGVHYFFERLANAGKDTRALAGVKIAVVGKKTAESLKQYGLLADYIPPDFVAD
SLIEHFPENLSGQKILFPRVETGGREVLVKDLSVVGAEVVEVAAYQSGCPKQINPQAWQV
LQEGMADIVTFASSKTVQNFYHLVKVALTSKSKYTPQSLLENVCLASIGPQTSKTCYEAF
GRVDVEAQEYTLEGLTAALIQWAKTQN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacctctggaaaagtatctctcattggcgcagggcccggaagcattgcctacctcacc
ctcaaaggacaacacctcttatcccaagcagaagttttaatttatgatgaccttgtagat
ccccaactgttgcaacttgtcccctctaactgtgtgcaacttcacgtcggaaaacgcggc
ggatcacctagcactccacaggatattattaatctactcttagtggacttttgctcacag
ggtaaacaagtggtgcggctaaaaggtggcgatccctttatttttggacgggccaaccca
gaaataggggctctgatagcggccaactgtcattatgaggtgatccccggcatttcttcg
gctttagccgcccctttgctggccggaatacccctcaccgataaagacttgagtcgctgt
tttgtcgttctcagcgcccatgaccctgatatcctagattgggatgccatcgccaaaata
gataccatcgtcattttaatggggggacgtttcctagaagacattattcaaaacttgcaa
gaaaaaggacgatcacctagcactcccattgctattatccgccactgcgcccgtcctgag
caacaggtttggataggtacattaggagatatagtggatcagataacagaagagtctctc
tctcctaccgtgatggttattggtgatgttgttaagcttcggaatatgactacctctccc
tctcttcccctatccggaaaaaccgttattgttactcgcgcggcggaacaatctagtaaa
tttagcgacctcttacaagaacaaggggcgacagtaattgaaatgccggctttagaaatt
acccccccttcgagttgggaaggattagatcaggcgatcgccaccttaaaagattttcac
tggttaattcttacctccgctaacggggtacattatttttttgaacggttagccaatgcc
ggcaaagatacccgtgccttagcaggcgttaaaattgctgtggtaggcaaaaaaacagca
gagagtctcaaacagtatgggttactagcagattatattcccccggattttgtggcagac
tcgttaattgaacattttccagaaaatttgtccggccaaaaaatcctttttccccgggta
gaaactggagggagagaagtattagtgaaagatttatctgtggttggcgctgaggtggta
gaagtggcggcttatcagtcaggatgtcctaaacagattaaccctcaagcgtggcaagtt
ttgcaagagggaatggcagacattgttacctttgctagttctaaaaccgtccaaaatttc
tatcatttagttaaagtggcattaacatcaaaatcaaaatatacccctcaatctttgtta
gaaaacgtttgtcttgcttctattgggcctcaaacttcaaaaacttgttatgaggctttt
ggccgagtagatgtggaggcgcaagaatatactttggaagggttgacggcggcgttaatt
caatgggccaaaactcaaaattaa

DBGET integrated database retrieval system