KEGG   Cyanothece sp. PCC 7822: Cyan7822_4422Help
Entry
Cyan7822_4422     CDS       T01310                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cyj00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:cyj00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4875076..4877484)
Genome map
AA seq 802 aa AA seqDB search
MVAAPEKPILEQQPLSAEELRKIDAYWRACNYLAVGMIYLKDNPLLKRPLQPEDIKARLL
GHWGTSPGLSFTYVHLNRLIKKYDLDMIFLAGPGHGAPGVLGPVYLEGTYSEIYPDKSED
EEGLQKFFKQFSFPGHIGSHCTPETPGSIHEGGELGYSVSHAYGAAYDNPNLIVSVVVGD
GEAETGPLATAWHSNKYLNPIRDGAVLPILHLNGYKIANPTILARISPEELESLFIGYGY
TPYVVEGDDPHIMHQKMAATVEQCITQIRSIQEEARSSGVAKRPRWPMIILRTPKGWTGP
KEVDGKKVEGFWRAHQVPMGEMQNNPDHLKMLEDWMRTYKPEELFDETGKLIPELKELAP
KGIRRMSANPHANGGILRKDLKLPDFRDYAVSVSAAGKEEVANTGLLGEFLRDVIKNNPT
SFRLFGPDETASNRLQAVYEVTQKAWLANYLAEDEGGSLLSPDGRVMEMLSEHTLEGWLE
GYLLTGRHGLFHTYEAFAHVIDSMFNQHAKWLDICKHEVSWRVPISSLNILLSSVVWRQD
HNGFSHQDPGFIDLVTNKSAEVVRVYLPPDANCLLSVADHCLRSTNYVNVIVSDKQKHLQ
YLSMDEAIKHCTKGIGIWEWASNDDRDKEPDNPDVIMACCGDIPTMESLAATAILRAEFP
DLKVRFINVVDLFKLQSESEHPHGLSERDFDGLFTQDKPIIFNFHGYPWLIHKLTYRRSN
QERIHVRGYKEKGNINTPLELAINNEIDRFSLVIDVIDRVPKLGSAAAYVKERMKNEIID
NLHYARTHGMDKAEILDWKWPY
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagcaccagagaaacccattttagaacagcagcccttatctgctgaagaactg
cggaaaatagatgcttactggcgtgcctgcaattatttagccgttggtatgatttatctt
aaagacaaccccttgctcaaaagacccctgcaaccagaagatattaaagctcgtctgttg
ggacactggggaacctcacccggcttaagctttacctacgttcatcttaaccgcctaatt
aaaaaatatgacctagatatgatcttcttagccggacccggacatggcgcacccggggta
ctcggcccagtgtacttagagggaacctattcagaaatttaccccgataaaagcgaagac
gaagaagggttgcaaaaattcttcaaacagttctcttttccgggccacattggaagtcac
tgcacccctgaaacccccggctcaattcatgaaggcggggaattaggttatagtgtttct
cacgcctacggtgctgcctacgataacccgaatttaattgtatcagtggtggtgggtgac
ggagaagccgaaaccggacctttagcgacggcttggcactccaataaatacctcaacccc
attcgagacggggctgtattaccgatattgcacctaaacggctacaaaattgctaacccc
accattctcgcccgcattagtccagaagaactcgaaagcctctttattggctatggttac
actccttatgtagtagaaggagatgaccctcacatcatgcaccaaaagatggcagctacc
gtagaacagtgtattacccaaattcgcagcatccaagaagaagcccgcagtagcggcgtg
gcaaaacgtcctcgctggccgatgattatcttgcgtactcccaaaggatggacaggaccc
aaagaagtcgacggcaaaaaagtagaagggttttggcgggcgcatcaagtcccgatggga
gaaatgcaaaataaccctgaccatttaaaaatgctagaagactggatgagaacttataaa
cccgaggaactctttgacgagacgggtaaactcattcctgaactcaaagaactcgcaccc
aaaggcatacggcggatgagtgctaacccccatgctaacgggggaattctgcgaaaagat
ttaaaattaccggattttcgcgattatgcggtgagtgtctcagcagccggtaaagaggaa
gtggctaataccggcttactgggtgaatttttgcgggatgtaatcaaaaataaccctacc
tctttccgtctttttggtcctgatgaaacagcctctaaccgtcttcaagccgtctatgaa
gtaacccaaaaagcttggttagccaactacttagccgaagatgagggcggcagtttatta
tcacctgatggtcgagtcatggaaatgctcagtgagcataccttagaaggatggttagaa
ggctatcttctgacaggtcgtcatgggttatttcatacttatgaagcctttgctcacgtc
atcgactccatgtttaaccaacacgctaaatggttagatatctgtaaacatgaagtaagt
tggcgagtgcccatttcttctttaaatattctcctatcttcggtggtttggcggcaagac
cataacgggttcagccatcaagaccccggttttatcgatctagtgaccaataaaagtgca
gaagtagtgcgggtatatttgccccctgatgctaattgtctgttatctgtggccgatcac
tgcctacgcagtaccaattatgtcaatgtcatcgtctctgacaagcagaaacacctgcaa
tatctgagcatggatgaagccattaaacactgcaccaaaggcataggcatttgggaatgg
gccagtaatgatgatcgtgataaagaaccggataatcccgatgtaattatggcttgctgt
ggtgatattcccacgatggaatctttagccgctactgccattttacgcgcagaattccct
gacctaaaagtccgttttatcaacgtcgttgatctattcaaattacaatcagaaagcgaa
catcctcacgggttatctgagcgagattttgatggtttatttacccaagataaaccgatc
attttcaactttcacggttatccctggttaatccacaaattaacctatcgccgcagtaac
caagaacgcatccatgtgcgaggttacaaagaaaaaggcaatattaacacccccctagaa
ttggccattaataacgaaatagaccgctttagcttggtgatcgatgtgatcgatcgcgtt
cctaaactcggttcggcggcggcttatgtcaaagagcgcatgaaaaacgagatcatcgat
aacttacactatgcccgcactcacggcatggataaagcggaaattttggattggaagtgg
ccttattaa

DBGET integrated database retrieval system