KEGG   Cyanothece sp. PCC 7822: Cyan7822_4638Help
Entry
Cyan7822_4638     CDS       T01310                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.13)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_4638
   01230 Biosynthesis of amino acids
    Cyan7822_4638
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_4638
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7822_4638
Enzymes [BR:cyj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Cyan7822_4638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5070804..5071817
Genome map
AA seq 337 aa AA seqDB search
MIRVAINGFGRIGRNFLRCWLGRTDSQIDLVGLNDTSDPKTNAHLLKYDSMLGKLDADIR
ADENSIIVNGKTIKCYSDRNPLNLPWAEWGVDLIIESTGVFVDYEGASKHIVAGAKKVLI
TAPGKGPNIGTYVVGVNDSDYNHDEHEVISNASCTTNCLAPVVKVIHENFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAINIVPTSTGAAKAVALVIPEMKGKLNGIALRVPTPN
VSVVDLVAQVEKPTLAEQVNDVLKAAAEGSLKGVLEYNDLPLVSSDYRGTDCSSIIDASL
TMVMGGDMVKVVAWYDNEWGYSQRVVDLAELVARNWK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcgatcaacggattcggacgcattggacgcaattttttaagatgctgg
ctaggtcgcacagatagccagatagatctagtgggactcaatgatacttcagatcccaaa
accaatgctcacctgctcaaatatgactccatgttgggcaaattggatgctgatatcaga
gccgatgaaaattctattattgttaatggtaaaaccatcaagtgctattctgatcgcaat
cctctaaacttgccctgggctgaatggggagttgatttaatcatcgaatccactggggta
ttcgttgattatgaaggcgcttctaagcacattgtagctggcgcgaaaaaggttttgatt
accgcaccaggtaaagggccaaatatcggaacctatgtggtaggggttaacgatagtgat
tataatcatgatgagcatgaagtcatcagtaatgctagttgtaccaccaactgtctagca
cctgtggttaaggtgattcatgagaactttggcattatcaaaggaaccatgaccactacc
cacagctacaccggtgaccaacgaattttagatgctagtcaccgcgatctccgccgcgca
agagccgccgctattaatatcgttcctacttctaccggagcggctaaggcagtagcttta
gttattcctgaaatgaagggtaaattaaatgggatcgcgctgcgagttcctactcctaat
gtgtctgtggtagatttagtcgctcaagttgagaaaccgactcttgctgaacaagtcaat
gatgttcttaaagcggcggctgaaggttccctcaagggagttcttgagtataacgatctg
cctttggtttcttctgattaccggggaactgattgttcttctattatagatgccagcttg
acgatggttatgggcggcgacatggttaaagttgttgcttggtatgacaacgagtggggt
tattctcaacgggttgttgatttggctgaacttgttgctcgtaactggaagtaa

DBGET integrated database retrieval system