KEGG   Cyanothece sp. PCC 7822: Cyan7822_4864Help
Entry
Cyan7822_4864     CDS       T01310                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cyj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyj00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cyj00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cyj00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5284077..5285390
Genome map
AA seq 437 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVAKGETVVVVESDKADMDVESFFDGYLAAII
VNAGEEAPVGAAIALVAETQEEIKEAQAKAAAAQGNSGATVSETPSAPEPAPEPVLAAAG
GVSSAPSQSNGRLVASPRAKKLAKELGIDIKSLQGSGPFGRITGEDVERAAGKVSPPEPA
PISKPAPSQVPVAIPTPSAQPVVPAVAAPAGAASGEVVGFNTLQKAVVQNMVASMQAPQF
RVGYTITTDALDELYKKVKSKGVTMTALLAKAVAVTLQKHPVVNASYTDKGIQYHSSINI
AVAVAMPGGGLITPVLQQADQTDLYSLSRQWKDLVERARLKQLQPEEYSSGTFTISNLGM
FGVDRFDAILPVGQGSILAIGASRPQVVATAEGLLGVKRQMCVNITCDHRVIYGADAAAF
LQDLAKLIETNPQSLTL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgatatatttatgccggctctcagttccaccatgaccgaagggaaaatcgtc
tcttgggtaaaatctcctggagacaaagtggctaaaggggaaacagtggtcgtagtggag
tcggacaaggccgacatggacgttgaatcattctttgatggctatttagcggcaatcatc
gttaatgctggagaagaagctcccgtcggtgcagccatcgctcttgttgctgaaacccaa
gaagaaatcaaagaggcccaagccaaagcggctgcggctcaaggaaattcgggagcgaca
gtcagcgaaaccccatccgccccagaaccggcccctgaacccgttttagccgccgccggt
ggagtctcttctgccccgagtcaaagcaatggtcgtcttgtggcctctccgagagcgaaa
aaactcgcgaaagagctaggtattgacatcaaaagtctacaaggcagtgggccttttggc
agaattaccggagaagatgtagaacgggctgccggtaaagtttctccaccggagccggct
ccgatttccaagccagcaccgagccaggttccggtggcgattcccaccccttctgctcaa
ccggtggtgcctgcggtggcggccccggctggtgctgcaagcggcgaagtagtgggcttt
aataccctacaaaaagccgtagtacagaacatggtagccagtatgcaggctcctcagttc
cgggtaggatacaccattactactgatgctctcgatgaactctataaaaaagttaagagc
aaaggggtaaccatgacagctttattagctaaagcggtagcggttactttacaaaaacat
cccgttgtcaatgcgagttataccgataaaggcatacaataccactcatcgattaatatt
gccgtcgcagtagcgatgccgggtggtgggttaattacccctgtactgcaacaagcggac
caaacagatttgtattctctgtctcgtcagtggaaagatttggtagagcgtgcccgactc
aaacaactgcaacccgaagaatatagtagcggcacttttacaatttctaatttgggaatg
tttggcgttgatcgttttgatgctatcctgccggttggacaagggtcgatcttagccatc
ggtgcttctcgtcctcaagtggttgccactgctgaagggcttttaggggttaagcgtcaa
atgtgcgttaatattacctgtgatcaccgggtgatttatggggctgatgcggcggctttc
ctacaagatttggctaagttgatcgaaactaatccccaatctttaaccctttaa

DBGET integrated database retrieval system