KEGG   Cyanothece sp. PCC 7822: Cyan7822_4864Help
Entry
Cyan7822_4864     CDS       T01310                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_4864
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_4864
   00020 Citrate cycle (TCA cycle)
    Cyan7822_4864
   00620 Pyruvate metabolism
    Cyan7822_4864
Enzymes [BR:cyj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan7822_4864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5284077..5285390
Genome map
AA seq 437 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVAKGETVVVVESDKADMDVESFFDGYLAAII
VNAGEEAPVGAAIALVAETQEEIKEAQAKAAAAQGNSGATVSETPSAPEPAPEPVLAAAG
GVSSAPSQSNGRLVASPRAKKLAKELGIDIKSLQGSGPFGRITGEDVERAAGKVSPPEPA
PISKPAPSQVPVAIPTPSAQPVVPAVAAPAGAASGEVVGFNTLQKAVVQNMVASMQAPQF
RVGYTITTDALDELYKKVKSKGVTMTALLAKAVAVTLQKHPVVNASYTDKGIQYHSSINI
AVAVAMPGGGLITPVLQQADQTDLYSLSRQWKDLVERARLKQLQPEEYSSGTFTISNLGM
FGVDRFDAILPVGQGSILAIGASRPQVVATAEGLLGVKRQMCVNITCDHRVIYGADAAAF
LQDLAKLIETNPQSLTL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgatatatttatgccggctctcagttccaccatgaccgaagggaaaatcgtc
tcttgggtaaaatctcctggagacaaagtggctaaaggggaaacagtggtcgtagtggag
tcggacaaggccgacatggacgttgaatcattctttgatggctatttagcggcaatcatc
gttaatgctggagaagaagctcccgtcggtgcagccatcgctcttgttgctgaaacccaa
gaagaaatcaaagaggcccaagccaaagcggctgcggctcaaggaaattcgggagcgaca
gtcagcgaaaccccatccgccccagaaccggcccctgaacccgttttagccgccgccggt
ggagtctcttctgccccgagtcaaagcaatggtcgtcttgtggcctctccgagagcgaaa
aaactcgcgaaagagctaggtattgacatcaaaagtctacaaggcagtgggccttttggc
agaattaccggagaagatgtagaacgggctgccggtaaagtttctccaccggagccggct
ccgatttccaagccagcaccgagccaggttccggtggcgattcccaccccttctgctcaa
ccggtggtgcctgcggtggcggccccggctggtgctgcaagcggcgaagtagtgggcttt
aataccctacaaaaagccgtagtacagaacatggtagccagtatgcaggctcctcagttc
cgggtaggatacaccattactactgatgctctcgatgaactctataaaaaagttaagagc
aaaggggtaaccatgacagctttattagctaaagcggtagcggttactttacaaaaacat
cccgttgtcaatgcgagttataccgataaaggcatacaataccactcatcgattaatatt
gccgtcgcagtagcgatgccgggtggtgggttaattacccctgtactgcaacaagcggac
caaacagatttgtattctctgtctcgtcagtggaaagatttggtagagcgtgcccgactc
aaacaactgcaacccgaagaatatagtagcggcacttttacaatttctaatttgggaatg
tttggcgttgatcgttttgatgctatcctgccggttggacaagggtcgatcttagccatc
ggtgcttctcgtcctcaagtggttgccactgctgaagggcttttaggggttaagcgtcaa
atgtgcgttaatattacctgtgatcaccgggtgatttatggggctgatgcggcggctttc
ctacaagatttggctaagttgatcgaaactaatccccaatctttaaccctttaa

DBGET integrated database retrieval system