KEGG   Cyanothece sp. PCC 7822: Cyan7822_4957Help
Entry
Cyan7822_4957     CDS       T01310                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cyan7822_4957
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cyan7822_4957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5395194..5396111)
Genome map
AA seq 305 aa AA seqDB search
MAVIVLGSINIDLVVQVSHLPHKGETVIGNNFFTACGGKGANGAVAIAKLGIPVSMVGQV
GGDQFGETLLKGLQSAGVNTQGVIINPDTHSGVASIVVDQHGDNTIACAGGANSLVGDAE
IQQFKALLPGAKVVSLELGIPLDVVVAAASAASAADCIVILDPAPARNDLPDELYPLIDI
ITPNEVEASQLVGFPVIDPETATRAALILQQRGVKTVIVTLGSQGALCCSANETFFVPAL
SVSVVDTVAAGDAFNGGLVAALASGKSLPEAMQWATVAGALSVTQAGAQSSLPDRASFLQ
FLSSH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcggttattgttttaggtagtattaatattgaccttgtagtacaagtctctcatttg
ccccataaaggggaaactgtcatcggaaataatttttttaccgcttgtggaggaaaaggc
gctaatggggcggtagccatcgctaaattaggcattcctgtctctatggtgggacaagtg
ggaggagatcagtttggggaaactttactcaaaggattacaatctgccggagttaataca
caaggtgtgatcatcaatcctgatactcactcaggagtagcttctattgtagtagatcag
cacggtgataataccatcgcttgtgcgggtggggccaatagtctcgtcggggatgcagaa
atacaacaattcaaggctttacttcctggggcaaaagtggtttccttagaattgggtatt
cccctagatgtagtggtagcggcggcttcggcggcttcggcggctgattgtatcgtcatt
ttagaccctgctccggctcgcaacgatttacccgatgagctttatcctctgattgatatt
atcactcctaatgaagtagaagcctctcagttagtggggtttccagtaatagaccccgaa
accgcaacaagagcggctttaatcttacagcaacgcggagtcaaaaccgtgatcgttacc
ttgggaagtcaaggggcactctgttgtagtgctaatgaaaccttttttgtgcctgcgctt
tccgtgtccgtagtggataccgtagccgccggggatgcctttaatgggggcttagtggcg
gcattagcctctggtaagtctctgccggaagctatgcaatgggcgacagtagcaggggcg
ttatcggtgactcaagccggggcacaatcttctttaccagatcgggcaagttttctacaa
tttctcagtagtcattag

DBGET integrated database retrieval system