KEGG   Cyanothece sp. PCC 7822: Cyan7822_5078Help
Entry
Cyan7822_5078     CDS       T01310                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00500  Starch and sucrose metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
Module
cyj_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan7822_5078
Enzymes [BR:cyj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cyan7822_5078
Exosome [BR:cyj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan7822_5078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 AMPK1_CBM Alpha-amylase_C Malt_amylase_C GHL6
Motif
Other DBs
NCBI-ProteinID: ADN16965
JGI: Cyan7822_5078
UniProt: E0UJE7
Position
5511206..5512861
Genome map
AA seq 551 aa AA seqDB search
MANLIEFKLFAPYNKEVELIGSFSDWQSIQMKKDDQGYFRTKVELEDGVYQYKFRVRSRS
WFVEPDQWIDIVDPYATDVIDDADQKGVVRIKDGDIIVDTYVWKHDDKPLPADHELVIYE
MHVADFSGGEDDPYARGKYKHVIEKLDYLCELGINAIELMPVKEYPGEYSWGYNPRYFFA
TESSYGTTEGLKQLIDECHARGIRIIMDGIYNHSEASCPLTQIDHDYWYHHSPKDPDNNW
GPEFNYEHYDENLDVKPAWKFIGEVVRFWIEEYHIDGIRYDAAKQIANYDFMHWIVQETK
KVAGSKPFYNIAEHIPDTPTLTNLDGPMDGCWHDSFFHAMMPHLCGDRFDLEELKNVIDG
KRQGYMGTTNIVNYIGNHDHRRLMLELADRNIFDEAAFKRVKLGYAILMTAIGVPMIWMG
EEFGDYHPKEINPNKIDWTLLKNDSNKGLFEYVKGLVNLRKQNHALYTTNIDFFHENPET
QVLAYTRWNDEGSRIVVVANFSDNFLAGYEVPNFPANGNWHEWTMNYDVENSHDNLITDL
AEYEAKVFVWQ
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctaacttaattgaattcaaattatttgcaccctacaataaagaagttgaattaatc
ggctctttttcggattggcaatctatccagatgaaaaaggatgatcaaggctatttccgg
actaaagttgagttagaagacggtgtttatcaatataagttccgagttcgctcaagaagt
tggtttgttgaaccagatcaatggattgatattgttgatccttatgccactgatgtgatt
gatgatgccgatcaaaagggtgttgttcgcattaaagacggagatataattgttgatact
tacgtttggaaacatgatgataaacctctgccggcggatcatgaattagtcatctatgaa
atgcacgttgctgacttttcaggcggcgaagatgacccctatgcaagaggtaaatataag
cacgttattgaaaagttagattatctttgcgaattgggaatcaatgccatagaattgatg
ccagttaaagaatatccgggtgagtatagttggggttataatcctcgttatttctttgct
acagaatcgagttatggcactacagaaggcttaaaacaactgattgatgagtgtcatgcc
cgaggaatacggattattatggatgggatttataaccattcagaagcctcttgtcctttg
acacaaattgatcatgactattggtatcatcatagccctaaagaccctgacaataactgg
ggacctgaattcaattatgaacattatgacgaaaatttagacgttaaacccgcttggaag
tttatcggcgaggtggttcgtttttggattgaagaatatcatattgatggaattcgctac
gatgccgccaaacaaattgccaattatgatttcatgcactggatagttcaagaaacgaaa
aaagtagcgggttctaaacccttttataacattgctgaacatattcctgatacccctact
cttactaatctagatggcccaatggatggctgctggcatgatagctttttccatgccatg
atgcctcatctttgcggggatagatttgatctagaagaacttaaaaatgtgattgatggt
aagcgtcaaggctatatgggaaccactaatattgtcaattatattggcaatcacgaccat
agaagattgatgctagaattagctgaccgaaatatttttgatgaggcggcttttaaacga
gttaagctgggatatgctattctaatgacagcaatcggtgtgccgatgatttggatgggt
gaagagtttggcgattatcatcctaaagaaattaaccctaacaaaattgattggactctg
ttaaaaaatgattctaataaaggattgtttgaatacgttaaagggttagttaatttgaga
aaacaaaatcatgctctttataccactaatattgatttcttccatgaaaatcctgagact
caagtattagcttatactcgttggaatgatgaagggtctagaatagtggtagtggctaat
ttctcagataatttcctcgcgggttatgaagtgcctaattttccagctaacggcaattgg
catgaatggacaatgaattatgatgtagaaaatagtcatgataacctgatcactgatttg
gccgaatacgaagcaaaagtctttgtgtggcaataa

DBGET integrated database retrieval system