KEGG   Cyanothece sp. PCC 7822: Cyan7822_5078Help
Entry
Cyan7822_5078     CDS       T01310                                 

Definition
alpha amylase catalytic domain-containing protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan7822_5078
Enzymes [BR:cyj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cyan7822_5078
Exosome [BR:cyj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan7822_5078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5511206..5512861
Genome map
AA seq 551 aa AA seqDB search
MANLIEFKLFAPYNKEVELIGSFSDWQSIQMKKDDQGYFRTKVELEDGVYQYKFRVRSRS
WFVEPDQWIDIVDPYATDVIDDADQKGVVRIKDGDIIVDTYVWKHDDKPLPADHELVIYE
MHVADFSGGEDDPYARGKYKHVIEKLDYLCELGINAIELMPVKEYPGEYSWGYNPRYFFA
TESSYGTTEGLKQLIDECHARGIRIIMDGIYNHSEASCPLTQIDHDYWYHHSPKDPDNNW
GPEFNYEHYDENLDVKPAWKFIGEVVRFWIEEYHIDGIRYDAAKQIANYDFMHWIVQETK
KVAGSKPFYNIAEHIPDTPTLTNLDGPMDGCWHDSFFHAMMPHLCGDRFDLEELKNVIDG
KRQGYMGTTNIVNYIGNHDHRRLMLELADRNIFDEAAFKRVKLGYAILMTAIGVPMIWMG
EEFGDYHPKEINPNKIDWTLLKNDSNKGLFEYVKGLVNLRKQNHALYTTNIDFFHENPET
QVLAYTRWNDEGSRIVVVANFSDNFLAGYEVPNFPANGNWHEWTMNYDVENSHDNLITDL
AEYEAKVFVWQ
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctaacttaattgaattcaaattatttgcaccctacaataaagaagttgaattaatc
ggctctttttcggattggcaatctatccagatgaaaaaggatgatcaaggctatttccgg
actaaagttgagttagaagacggtgtttatcaatataagttccgagttcgctcaagaagt
tggtttgttgaaccagatcaatggattgatattgttgatccttatgccactgatgtgatt
gatgatgccgatcaaaagggtgttgttcgcattaaagacggagatataattgttgatact
tacgtttggaaacatgatgataaacctctgccggcggatcatgaattagtcatctatgaa
atgcacgttgctgacttttcaggcggcgaagatgacccctatgcaagaggtaaatataag
cacgttattgaaaagttagattatctttgcgaattgggaatcaatgccatagaattgatg
ccagttaaagaatatccgggtgagtatagttggggttataatcctcgttatttctttgct
acagaatcgagttatggcactacagaaggcttaaaacaactgattgatgagtgtcatgcc
cgaggaatacggattattatggatgggatttataaccattcagaagcctcttgtcctttg
acacaaattgatcatgactattggtatcatcatagccctaaagaccctgacaataactgg
ggacctgaattcaattatgaacattatgacgaaaatttagacgttaaacccgcttggaag
tttatcggcgaggtggttcgtttttggattgaagaatatcatattgatggaattcgctac
gatgccgccaaacaaattgccaattatgatttcatgcactggatagttcaagaaacgaaa
aaagtagcgggttctaaacccttttataacattgctgaacatattcctgatacccctact
cttactaatctagatggcccaatggatggctgctggcatgatagctttttccatgccatg
atgcctcatctttgcggggatagatttgatctagaagaacttaaaaatgtgattgatggt
aagcgtcaaggctatatgggaaccactaatattgtcaattatattggcaatcacgaccat
agaagattgatgctagaattagctgaccgaaatatttttgatgaggcggcttttaaacga
gttaagctgggatatgctattctaatgacagcaatcggtgtgccgatgatttggatgggt
gaagagtttggcgattatcatcctaaagaaattaaccctaacaaaattgattggactctg
ttaaaaaatgattctaataaaggattgtttgaatacgttaaagggttagttaatttgaga
aaacaaaatcatgctctttataccactaatattgatttcttccatgaaaatcctgagact
caagtattagcttatactcgttggaatgatgaagggtctagaatagtggtagtggctaat
ttctcagataatttcctcgcgggttatgaagtgcctaattttccagctaacggcaattgg
catgaatggacaatgaattatgatgtagaaaatagtcatgataacctgatcactgatttg
gccgaatacgaagcaaaagtctttgtgtggcaataa

DBGET integrated database retrieval system