KEGG   Cyanothece sp. PCC 7822: Cyan7822_5145Help
Entry
Cyan7822_5145     CDS       T01310                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cyj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5577856..5579355)
Genome map
AA seq 499 aa AA seqDB search
MNFERSSGIILQPTSLPSRFGIGDLGESAYRFIDFLEASGQKLWQILPLGPTGYEHSPYT
MNFSAFAGNHLLISLDRLVEEGLLQADELTPLPDSDQDDPNIVNFNRVIPHKTQFLKLAY
SRFKPSSEYEQFCQEQSAWLEDYSLFMALLEENGGKNWNQWETGIARREPEAIKAKTESL
KDSINYHNFLQFKFFEQWKALRAYANNKNIKIIGDISIYVCYNSADVWANPQCFKLDPQT
LESTYIAGVPPDYFSATGQLWGNPVYNWDYLQKTDYEWWFKRFEATLQYADFVRIDHFRG
FEAYWQVPAGEETAINGEWVKAPGEEFFEKLGRRLGSLPVLAEDLGIITPEVEALRDQFE
FPGMRILLFAFDGDTENAYLPHHYVKNCAVYIGTHDNDTAIGWWEKASDEEKRRVAEYLG
YSSPEEIKEINWVLLRLGFASVANLAIVQLQDVLGLDNRARMNDPSKNEDNWRWRYTSSD
LLTQELSQRLLKVTQLYSR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaacgttccagtgggattattttacagccaactagcttacctagtcgtttt
ggcattggggatttaggagaatcagcttatcgatttattgattttctcgaagcaagtggt
caaaagttatggcaaattttacctcttgggcccactggttacgaacattccccctacacc
atgaattttagtgcttttgcggggaatcatttactgattagtcttgatcgtctcgtggaa
gagggtttacttcaggccgatgaattaacgccgcttcctgactcagatcaggatgacccc
aatattgttaattttaatcgcgtcatcccccataagactcaatttctaaaactggcttat
tcgaggtttaaaccgagttctgagtatgaacaattttgtcaggaacaatcagcctggtta
gaggattattccctattcatggcgcttttagaagagaatggcggcaaaaattggaatcaa
tgggaaaccgggatcgcgcggcgagaacccgaagcgataaaagctaaaacagaaagccta
aaagattcaattaattatcataatttcttacaatttaaattctttgaacaatggaaagcc
ttaagggcttatgctaataataaaaatattaaaattattggcgatatttccatttatgtt
tgctataacagtgcggatgtttgggcgaatcctcaatgttttaaattagaccctcaaact
cttgaatcgacttatattgcaggtgttccgccggattatttcagcgctaccgggcaactt
tggggcaatccggtttataactgggattatctacaaaaaaccgattatgaatggtggttt
aagcgctttgaagcgacgttacaatatgccgattttgttcgtatcgatcattttcgcggc
tttgaggcttattggcaagttccggcaggggaagaaactgctattaatggagaatgggtt
aaagcgccgggtgaggagttttttgagaaattggggcggcgtttgggaagtttgccggta
ttagcagaagatttgggcattattaccccagaggtagaagcgttacgggatcaatttgag
tttccgggtatgcggattttactgtttgcttttgatggggatacagaaaatgcttattta
ccccatcattatgtgaaaaattgtgcggtttatatcggtactcatgataatgatacggcg
attggttggtgggagaaagcaagtgatgaggaaaagcggcgtgttgctgagtatttaggt
tatagttcaccggaagagattaaggagattaattgggtgttgttgcgtttgggttttgct
tcggtggcgaatctggcgatcgttcagttacaggatgttttggggttagataaccgcgcg
aggatgaatgatccgagtaagaatgaggataactggcgctggcgttatacctcttctgat
ttgttgactcaggagttgagtcagcgtttgcttaaggtgactcaattgtatagccgctaa

DBGET integrated database retrieval system