KEGG   Cyanothece sp. PCC 7822: Cyan7822_5258Help
Entry
Cyan7822_5258     CDS       T01310                                 

Definition
(GenBank) diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s)
Organism
cyj  Cyanothece sp. PCC 7822
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5700728..5704294)
Genome map
AA seq 1188 aa AA seqDB search
MSYHLATESLNLSLGGLVLFILISWIIKLKKYSSLAQSLAYSKTQLEENLLEAQIKIKSL
EEELQAAREENKLLETKLKIRQHLLEFQKDNLKQNGLKKLRESSQAAKTCQVILKNYSQD
EQGNCTNCIGVKTDVTEPKQAEIQRERFFTLSLDLLCIAGFDGYFKCLNPAWETTLGYST
EELISQPFIELIHPDEREAALTEIERLGRGQLTYHFENRYRTREGTYRWLTLTAVPYVEE
GLIYAVAHDITKRKQTEAEIQQTRNFLQTMIDHLPLAVFVKDGKPETFSQIILWNKTCEK
IFGISATEAIGSTTFEHFSDSQAEFFYQKDRETFARRMPLEIPEEEADSYSLGKRLLHTV
KIPLYDEQDQPQYLLCISEDITERKRAEEALKKSEEQFRLVFQHSPIGIAIATPEGKLVR
VNEAFSQMMGFTEAELLKRTCGDLTYPDDLKNEIPLHQKLLAGEIAYYRLEKRYLTKKGQ
VLYGMLHVGLIRDEQDKPLNLVGQVVDISEKTQAEIALRESEDRLSRIITTISDGLIVVN
NQGNIKFINPAGEKLFGRSQEELLEQHFGVPFVDGKTTEIFIRHANQQLIVAEMRVGLII
WEQQKAHLISLRDITERKQIEKALSESEQRLESILNSIEDVVWSTSATTLNLIYLNPATE
RVYGCSIEQLLAEGNLWFNLVHPDDQALIDAHFKALEDTGHSEYEYRIVRPDGTVRWLYS
RSRTIYDPTGKPIRFEGIDSDITERKSFTEQLQYNAYHDPLTSLPNRIFLLEKLEEALKK
NQNRENIFFAVLFLDLDDFKVVNDSLGHIVGDQLLIAIAQRLKTSLSVPHTLARFGGDEF
TILLEEIQSTDEPLKAAQKIHNDLTQPYDLNGQQVFISTSIGIALSDPSYIHPQEILRDA
DTAMYQAKRWGKGGYAVFDQQMHLRAVKRLHLEIELRQAIELKEFLLYYQPIVSLSTGYL
TGFEALIRWQHPKKGLISPVEFIPIAEETGLIVPMGKWITQQACRQLKLWQEQYNLKNPL
QISVNLSSKQLRNSHLIEEIDEILAQTGIDPSSLKLEITESMLMENVDIAMNILIELRKR
NIELCLDDFGTGYSSLSYLHRFPVTTVKIDRSFVMQMQPGNSNAEIVHAIITLAHSLEMT
VTAEGVETQLQLQQLQWLECEQAQGYFFSKPLPPKEAGTLIQAFPCWK
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcatctcgctacagaaagtcttaatttaagtctaggaggactcgtgttattt
atcctaatctcttggataataaaattgaaaaaatattccagtttggctcaatctctggct
tattcaaaaactcaattagaagaaaacttattagaagcacaaataaaaattaaatccctg
gaagaagaattgcaggcagctagagaagaaaacaaattactagaaacaaagcttaaaata
agacaacatttgttagagtttcaaaaagataatttgaaacaaaatggtctaaaaaagctc
agagaatctagtcaagcagcaaaaacctgtcaggttatcctaaaaaattatagccaagac
gagcaaggaaattgtaccaattgtattggcgttaaaactgatgttaccgaacctaaacaa
gctgaaatacaacgagagcgtttttttacgctttcattagacctactttgtattgctgga
tttgatggctatttcaaatgcttaaatcctgcttgggaaactacgctaggatattctaca
gaagaactcataagtcaacccttcatagaattaattcatcctgatgaacgagaagccgcc
ttaacagaaatcgaacgactaggtagaggacaattaacttaccactttgaaaatcgctat
cgcactcgagaaggaacttatcgctggttaactttgacagccgttccttatgtagaagaa
gggttaatttatgctgttgctcacgatattactaagcgaaaacagactgaggcagaaatt
cagcaaacccgcaattttttacaaacgatgattgaccatttacccttagcggtctttgtt
aaagatggtaaacccgaaacatttagtcaaataattttatggaacaaaacctgtgaaaaa
atttttggaatcagtgccacagaagccatcggttcaacaacttttgagcatttctctgac
tcgcaagccgaatttttttaccaaaaagatcgagagacttttgcccgccgtatgccgcta
gaaatccccgaagaagaggcggatagctactcgttaggaaaaagactacttcataccgta
aaaattcccctttacgatgagcaagatcaaccgcaatatttactctgtatttctgaagat
attactgagcgaaaacgagccgaagaagcccttaaaaaaagtgaagaacaattccggcta
gtctttcaacactcgcctataggcatagccatagctactccagaaggaaaattagtgcga
gttaatgaggcattttctcagatgatgggttttacagaagccgaattactcaagcgcact
tgtggagatttaacctatcctgatgacctaaaaaatgaaatacctctccatcaaaaatta
ttagccggagaaattgcctactaccgtctggaaaaacgttatttaaccaaaaaaggccaa
gttctttatggaatgcttcacgtaggattgattagagacgaacaagacaaacccctaaat
ttagtgggtcaagtggtggatattagcgaaaaaactcaagccgagatcgccttacgagaa
agtgaagatcgtttaagccgcattattaccactatctctgatgggttaattgtcgtaaat
aaccaaggaaatattaaatttattaatcccgcaggcgagaaactttttggacgttctcaa
gaggaattgctcgagcaacattttggtgttccttttgtggatggaaaaaccaccgaaatt
tttattcgtcatgctaaccaacaactgattgttgctgaaatgcgggtagggctaattatc
tgggaacagcaaaaagctcatttaatctctcttagagatattactgagcgcaaacaaata
gaaaaagctctctctgaaagtgagcaacgcctagaaagtattcttaattctattgaagat
gtcgtttggtcaacttcggccaccactttaaacctgatttatcttaatcccgctaccgaa
agagtatatggctgttcgattgagcaattgttggcagaaggaaatctttggtttaacctg
gtacaccctgacgatcaagcacttatcgatgctcatttcaaagctctcgaggacacagga
catagtgaatatgaatatcgcattgtgcgaccagatggaacagttcgctggctttacagt
cgttctcgtaccatttatgaccctactggaaaaccgattcgttttgagggaattgatagc
gatatcactgagcgcaaatcctttaccgaacaacttcaatataatgcctatcacgacccc
ctcaccagtctacccaatcgtatctttttattggaaaaattagaagaagccctgaaaaaa
aatcaaaaccgagaaaatattttttttgcggttcttttcctcgatctcgatgactttaaa
gtggttaatgatagtttaggtcatattgtcggggatcaactcttgatagccatcgctcaa
cgtctaaaaaccagcttgagtgtgccgcatactctagcccggtttgggggtgatgaattt
accattctcttagaagagattcaaagtaccgatgagccgctcaaagccgctcaaaaaatt
cacaacgacctgactcagccttatgacctcaatggtcaacaagtttttatcagtaccagt
attggtattgcgctgagtgatcccagttatattcatccacaggaaatattacgagatgcc
gataccgccatgtatcaggctaaaagatggggaaagggaggttatgcagtttttgatcaa
caaatgcacctacgagccgttaaacgtttacacttagaaattgaactgcggcaagccatt
gagctaaaagaatttttattatattatcaaccaattgtgtccttaagtacgggttattta
actgggtttgaagccttaattcgttggcaacatccgaaaaaaggattgatctccccggtt
gagtttattcctattgctgaagaaacaggtttaattgtaccgatgggaaaatggattact
caacaggcttgtcgccaacttaaattgtggcaagagcaatataacctgaaaaatcccttg
caaattagcgtcaatctttctagtaaacaactgaggaattctcatctcatagaagaaatt
gatgagattttggcacagaccggcatagacccgagcagtttaaaattagaaataacggag
agtatgttaatggaaaatgtggatatagccatgaatattctcattgaactgcgaaagcgt
aatatagaattatgcttggatgattttgggacgggatattcttctttaagttatttacat
cgttttccggtgactaccgttaagattgatcgctcctttgtcatgcagatgcagccgggc
aatagcaatgcagaaattgttcatgccatcattactctggcacactctttagagatgaca
gtgaccgcagaaggcgtagaaactcagttgcaattacagcaactccaatggttagaatgt
gaacaggcacagggttatttcttttctaaacctttgccgccaaaagaagcaggcacttta
attcaagcttttccctgttggaaataa

DBGET integrated database retrieval system