KEGG   Cyanothece sp. PCC 7822: Cyan7822_5327Help
Entry
Cyan7822_5327     CDS       T01310                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyj01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cyj00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5788844..5790163
Genome map
AA seq 439 aa AA seqDB search
MLRIITQQTEAQTELKRIRDRTRDLEFRQAEETVRDILDAVKRKGNQALIDYTEPFSQQV
LNPQQLKVSGSDLDAAYQQISKEALVAIQQACRQIENFHRQRLPKSWVQFQEDDVVLGRR
YQAVERAGLYVPDAPFPLMSLVLLQAIPAKVASVGQIVMVTPPNTTGKIHPALLVAAIEA
GVTDIYRLGGALAIGALAYGTETIPKVDVITGLGNIYVTLAKKMVYDSVKIDALAEASEL
VIIADDSANPMAIAADLVGQAERTPLAASILLTTDADMASTVSQQVAQQLQHHPQRILTE
KALAHYGLIVVVNSLVEAVQLSNFFAPQHLELAVSEPWELLEQVRHAGAIFLGTSTPMMV
GDFLGGSAMSVATAGAVRYASALGVETFMKHSNLIEYSPVALKKMSNTLQVLAQAEGLFA
GVESIRLRTEAQETDDNQL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattataactcagcagactgaggcacaaacagagcttaagcgcattcgggat
cgcacccgcgatttagagtttcgccaagcagaagagaccgtcagagacattttagacgcg
gttaagcgtaagggaaatcaggcactgatagattatacagaaccgttttctcagcaggta
cttaacccacaacaattaaaagttagtggctcagaccttgatgcggcttatcaacaaatt
tctaaggaagctctggtggcaattcagcaagcttgccggcaaatcgaaaattttcatcgc
cagcgtcttcctaaatcttgggttcagtttcaagaggatgatgtggtactgggaaggcgt
taccaagcagtagagcgagcgggtttatatgtgcctgatgcgccctttcccctgatgagt
ttggtactattacaagctatccccgctaaagtggcttctgtgggtcaaattgtcatggtc
actccgcctaataccacaggaaaaattcatccggctcttttagtggcggcaatagaagcg
ggagtcactgatatttatcgccttggtggggctttggccattggcgctttagcttacggg
accgaaaccatccctaaagttgatgtcattacagggctaggcaatatttatgtaaccctg
gcaaaaaagatggtctatgactcggtgaaaatcgatgctttggcggaagcttctgaattg
gtgattattgctgatgatagtgctaatcctatggcgattgcggctgatttagtgggccaa
gctgaacggactcctttagcggcttcgattttgttgactaccgatgcggatatggcttcg
acggtgagtcagcaggtggctcaacaattacagcatcacccccaaaggattttaaccgag
aaggcactcgctcattatgggttaattgtagtggtgaactctcttgttgaggcggtgcag
ttatctaatttctttgctcctcaacatttggaattagcggtatctgagccttgggaactt
ttagaacaggttcgtcatgctggggcgatttttttgggcacttctacgcctatgatggtg
ggggatttcttgggaggttcggctatgtctgtggctactgccggggcggtacgttatgct
tctgctttgggagtagaaacctttatgaagcattctaatttgatcgaatattctcctgta
gctttaaagaaaatgtctaatacgcttcaagttcttgctcaagctgaaggattatttgct
ggggttgagtcaatcagattacgtacagaagcccaagagactgatgataatcaattgtaa

DBGET integrated database retrieval system