KEGG   Cyanothece sp. PCC 7822: Cyan7822_5589Help
Entry
Cyan7822_5589     CDS       T01310                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan7822_5589
Enzymes [BR:cyj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cyan7822_5589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6069713..6070456)
Genome map
AA seq 247 aa AA seqDB search
MTVAPSNGYNRANSSNSSNVTAANSNILNPNLVDRVSTRPDRNTHNGQPAQIHLASVDSK
AQMSDAVRMILEAVGEDPDREGLLKTPKRVAEAMQFLTQGYNQSLEEIVNGAIFDEGHNE
MVLVRDIDFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQ
IAEAIKEILEPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMLGVFQEEQKTREEFLNLI
HHRPNFM
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacagtagctccttctaacggatacaatcgcgctaattcttctaattcttctaacgtg
acagcagctaattccaatatccttaatcccaatttagttgatcgggtttctactcgacca
gatcgcaatactcacaacggtcaaccggcccaaattcatctagctagtgtagacagcaaa
gcacaaatgagcgatgccgtacggatgattttagaggcagtgggagaagacccagatcga
gagggacttttaaaaacgcctaagcgtgtggccgaagcgatgcagtttctcacccaagga
tacaatcagtctcttgaagaaatcgtcaatggtgctatctttgatgaagggcataatgag
atggtactggtacgagatattgatttcttcagtctgtgtgagcatcatatgttgcctttt
atgggtagagcgcacgtggcctacattcctaatcaaaaagtagtgggattgagtaaatta
gcgcgaattgtagaaatgtattctcgccgcttacaagttcaagagcgactgacccgtcaa
attgccgaagccattaaagaaattttagaacctcaaggggttgctgtggtcatggaagcg
actcatatgtgtatggtgatgagaggagttcaaaaacctggatcttggacggttaccagt
gccatgttgggagtttttcaagaagaacaaaaaacccgtgaagaatttttgaatttaata
catcatcgtcccaattttatgtaa

DBGET integrated database retrieval system