KEGG   Cyanothece sp. PCC 7822: Cyan7822_5605Help
Entry
Cyan7822_5605     CDS       T01310                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_5605
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_5605
   00052 Galactose metabolism
    Cyan7822_5605
   00500 Starch and sucrose metabolism
    Cyan7822_5605
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan7822_5605
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cyan7822_5605
   00524 Butirosin and neomycin biosynthesis
    Cyan7822_5605
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cyan7822_5605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6089959..6090858)
Genome map
AA seq 299 aa AA seqDB search
MTNQAVIGIDLGGTAIKLGTFLPDGTATESITIPTPQPATPQAVLESIVTAVKQLNRDNN
CLAIGLGTPGPADAAGRIAKVAINLSGWRDVPLADWLEKETNLPTILANDANCAGLGEAW
LGAGRPFKNLILLTLGTGVGGAIILDGKLFTGSGGAAAELGLISLNPDGPPCNSGNQGSL
EQYACIGAIRRQTGKEPIELGKLAQEGDPDALAFWRQYGRILGVGIANFLYVLTPEAVII
GGGISASSRFFFPAILSEIESRVLPICREGLQLLEAQLGNNAGMVGAARLAWQNLVGES
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgactaaccaagctgttatcggtattgatttagggggaactgccattaaattaggtact
ttcctccctgatggaactgcaactgaatctatcactattccgactcctcaacctgctacc
cctcaagctgttttagaaagtattgtgactgcggttaagcaactcaatagagacaataat
tgtcttgccatcgggttaggaacgccggggcctgcggatgctgccggtagaattgctaaa
gtagccattaatttatccggttggcgagatgttcccctggcagactggttagaaaaggaa
acgaatttacctactattctggctaatgatgctaattgtgcgggtttaggagaagcttgg
ttaggcgctggtagaccctttaaaaatttgattttgttaacgttaggtacgggggtaggc
ggcgcgattatcctggatggtaagttatttactggttctggaggggcagccgcagaattg
gggttaattagtttaaatcctgatggacctccttgtaatagtggaaatcagggttcttta
gaacaatatgcctgtataggggcgattcgacgacagacggggaaagaacctattgagtta
ggaaagttggcacaagaaggcgatccggatgctttggctttttggcggcaatatgggcgg
attttaggagtgggaatcgctaattttctttatgttttaacccctgaagcggtgattatt
ggcggcgggataagcgcttcttctcggtttttctttccggctattttaagcgaaattgag
agcagagttttacccatttgtcgagagggtttacagttgttggaggcgcaattgggcaat
aatgcgggaatggttggcgcggctaggttggcctggcaaaatttggttggtgaatcttag

DBGET integrated database retrieval system