KEGG   Cyanothece sp. PCC 7822: Cyan7822_5767Help
Entry
Cyan7822_5767     CDS       T01310                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7822_5767
   01230 Biosynthesis of amino acids
    Cyan7822_5767
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_5767
  Energy metabolism
   00680 Methane metabolism
    Cyan7822_5767
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7822_5767
Enzymes [BR:cyj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cyan7822_5767
Exosome [BR:cyj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cyan7822_5767
  Exosomal proteins of melanoma cells
   Cyan7822_5767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Cy782201:229223..229924
Genome map
AA seq 233 aa AA seqDB search
MAKLILLRHGQSLWNAANKFTGWVDIPLSEQGRAEAMIASCKLRAHNYRIDMCFTSMLFR
AMETAVICLTECDEICGNKIPIFKHDATDPNWHGWDKYEGNGEDELPIFPTVALDERYYG
DLQGLNKQETAEKYGKYQVQEWRRSFNVRPPGGESLEDTLKRTLPFFQEHILKQVTQGNN
VLIAAHGNSLRSIIMSLENIPEQEIPHLELATGVPIVYDIDVTGKMTRKLILN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactaattttattaagacatgggcaaagcctttggaacgctgccaacaagttt
accggttgggtagacattcctttaagcgaacaaggacgggccgaggcaatgatcgcttct
tgcaaacttagggcacataactatcgtattgatatgtgcttcacgagtatgctatttaga
gcgatggaaactgcggttatttgtttaactgagtgtgatgaaatttgtggcaataaaatt
cctatatttaaacatgatgcaacggaccctaattggcacggttgggacaagtatgaaggc
aatggtgaagacgaattacctatttttccaactgtggctttagatgaacgttattatgga
gacttacaaggattaaacaaacaagaaacagccgaaaaatatggtaaatatcaagtgcaa
gaatggcggcgttcctttaatgtacgtccacctggcggcgaaagtttagaggataccctt
aagcgtaccttacccttttttcaagaacatattcttaaacaggttacacaaggaaacaat
gttttaattgccgctcatggtaactctttgcgttccatcattatgagtttagaaaatatt
cctgagcaagaaattcctcatcttgagttagctactggtgttcccatcgtttatgatatt
gatgtcaccggcaaaatgacccgtaaactcattttaaactaa

DBGET integrated database retrieval system