KEGG   Cyanothece sp. PCC 7822: Cyan7822_6109Help
Entry
Cyan7822_6109     CDS       T01310                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cyj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Cy782201:782749..785148
Genome map
AA seq 799 aa AA seqDB search
MVKFINQSQAFGCPGVAPRWTHGNKDGIGTALFSASRVWFTIWNGIITEVYYPTIDRPQI
RDLQYLISDNQSFFQEEKRDLHSKIERIWDHGLGYRILNHDPQERYTIIKEVISDPQLSC
ILQHTQLVGEPSIVSKLHLYALCSPHLNVGGKDNNAHIIEVAGQKILVAEKDDTWLALGA
TIPFTKLSCGYVGESDGWTDLQDNCQMDWEFSQALNGNVALMGKLALNPENKFTLGLAFG
NSLHNAISTLFQSLEIPFCQQKSTYQKQWQEKNKNIISLKQKSGDQGNLYQSSVSLLLAH
EDKSYPGAIIASLSIPWGEARDDQSPGGYHLVWTRDMVSSAIGLMAAGDHQTARRALIYL
ATNQEENGGFAQNFWINGTPYWQGIQLDEVAFPIILAWKLHTQKLISNFDIYPMVIRAAK
FLVHHGPVTQQERWEETSGFSPFTLASNIAALICAGALARERNDSTTAQFLEEYADFLES
HLETWTVTTEGTLVPDIKRHYIRITPASVDDPCPNENPNEGILSIANQPPGQKSEFPAKE
IVATGFLQLVRFGIRKPDDPIIVDSVKVIDAVLKVDTLFGPCWHRYNHDGYGQRPDGQPY
QGWGKGRAWPLLTGERGHYELMRGNDVTPYIKAMEGFATDTGLLPEQVWDEPDRPEINMF
LGKSTGSAMPLMWAHSEYIKLLRSTEDGQVFDWIPEVAERYLGNRNSCKNLEIWKFNRQV
KQVKPGWTLRIQALAPFQLHWSQDNWQTVHNFQSTCTSVDVYYVNIPVNAEQKAPIYFTF
LWTEGNQWENKNYQVEIWH
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggttaagtttatcaatcaatctcaagcttttggttgtccaggggttgctcctagatgg
acgcatgggaataaagacggaattggaacggctctttttagcgctagtcgtgtctggttt
acaatttggaacggcataataacagaagtttattacccgacaattgatcgtccacaaata
cgagatttacaataccttattagtgacaatcaaagcttttttcaagaagaaaagcgcgat
ctccattcaaaaatagaaagaatctgggatcatgggttaggatatcgcattttaaatcac
gatcctcaagaacgttacacgattatcaaagaagtcattagcgatcctcaactttcttgt
attttgcagcacacccaattagtcggtgaaccttctattgtctccaaacttcacttatat
gctctatgttctcctcatttaaatgttgggggcaaggacaataatgctcatattattgaa
gtagccggacagaaaatattggtagccgaaaaagatgatacttggttagcattaggagca
acaattccttttactaaattatcttgtggttatgtaggagaaagcgatggttggacagac
cttcaagataattgtcagatggattgggaattttctcaagccttaaatggcaatgtagcc
ttaatgggaaaactcgctctaaacccggaaaataaatttactttaggtctagcttttggg
aacagtttgcataatgctatttctactttatttcaatctttagaaatccccttttgtcaa
caaaaatcgacttatcaaaagcaatggcaagagaaaaataaaaatattatttctctaaaa
caaaaatctggcgatcagggtaatctttatcaaagtagtgttagtcttttattagctcat
gaagataaatcctatccaggtgctattattgcctctctttctattccttggggtgaagca
agagacgatcaaagtcccggaggatatcaccttgtttggactagagatatggttagcagt
gccattggtttgatggccgcaggagatcaccaaactgcccggcgagcgcttatttatttg
gcaacaaatcaagaagaaaacggaggttttgcccaaaatttctggattaatggcactcct
tactggcaaggaattcaattagatgaggtggcttttccgattatattggcttggaaactt
catactcaaaaacttatctcaaattttgacatttatcctatggtaatacgagccgcaaaa
tttctagtacatcacggtccggttactcaacaagagcgctgggaagaaaccagtggtttt
tctccttttactctcgcttctaatattgcggccttaatttgtgccggagccttggctcgg
gagcgaaatgactcgacaacggctcaatttttggaagaatacgcagatttcctagaaagt
catctagaaacttggacggtaactacagaaggaactctagttcccgatattaaacgccat
tatattcgcattactccggctagtgttgatgatccctgtccgaatgaaaacccgaatgag
ggaattttatcaattgctaatcaacctcccggtcaaaaaagtgaatttccggctaaagaa
attgtagctactggttttttacaattagtgcgttttgggattcgtaaaccagatgatccg
attattgtggattctgttaaagtgattgatgctgttttaaaagtagatactctctttggc
ccttgctggcatcgctataatcatgatggttatggacaaagaccagatggtcaaccttat
caaggttggggtaaaggtcgcgcttggcctttacttactggagagcgaggacattatgaa
ttgatgaggggaaatgatgtcactccctatattaaggcgatggaaggatttgcgactgat
acaggattactaccagagcaagtttgggacgaaccggatcgtcctgagattaatatgttt
ttaggcaaatccaccggctctgctatgcctttgatgtgggcccattctgaatatattaag
ctattgcgttcaactgaagatggtcaggtgtttgactggattcctgaagtagctgaacgt
tatttaggtaatcgcaattcctgtaaaaatcttgaaatttggaaatttaaccgacaggta
aaacaagttaaaccaggctggactttaagaatacaagcacttgctccttttcaattacat
tggtcacaagataattggcaaacggttcataattttcaatctacttgcacttcggtagat
gtctattatgtaaatattcctgtaaatgccgagcagaaagcacctatctattttaccttt
ctttggacagagggtaatcaatgggaaaacaaaaattatcaagttgaaatatggcattaa

DBGET integrated database retrieval system