KEGG   Cyanothece sp. PCC 7822: Cyan7822_6490Help
Entry
Cyan7822_6490     CDS       T01310                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyan7822_6490
Enzymes [BR:cyj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cyan7822_6490
Peptidases [BR:cyj01002]
 Cysteine Peptidases
  Family C44
   Cyan7822_6490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Cy782202:319329..321029
Genome map
AA seq 566 aa AA seqDB search
MRKRKSVNLLSVHPSWCLIWGQINTQLNEYSFSVPGKLGLVGSQPVFSPQKGFLVVGDVW
LVNRDRVLRSLGVSLSDWKGTDEEVVAFAWERWGTECVKQFMGFFALIVWDVAANRLWLV
RDSVGVRTLYYCYSGSSYYIAPRLKNLSSFHSQQLDLVALRDYLSTAFVAGERTLWEQVK
ELLPGTILSLSDGKINRYWQPIEQILEPDQSLAWYSNKLRDLLEQVIREYLPQNESVGVY
LSGGLDSSCVTALAARLHSASVHTYSIFFGADSPHELEFSSQVAQFCRTEHHILEITPQQ
MWNQLPETMAHLDDPIGDPLTVPNYLMAQLAGGNVQVILNGEGGDPCFGGPKNQPMLLNQ
LYNQTENQSNLMTAYLTSFQKCFLDLPRLLKPDVLAVVESSSFPFEADLNSETTYLNRLM
CINIKFKGADHILTKVNNLTRSALLEGRSPLFDRRIVELAMQIPPQYKLAGAEEKAVLKQ
AVIDLLPIEIIKRPKSGMMVPVQLWFKKYWQREARKLLLNKNAKIAPYFNQKVIRDWLNY
QGDPWGRYGVKLWLLLSLEIWLEVNQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcgcaagagtgttaatttgttgtcggtacatcccagttggtgtttaatttgg
ggacagataaatactcaattaaatgagtatagtttttctgtccctggcaagttgggtctg
gtgggttctcaacctgtttttagtcctcaaaaaggttttttggtagtaggagatgtttgg
ttagttaatcgagatcgagttttgagaagtttgggagttagtttaagtgattggaaaggt
acagatgaggaggttgttgcttttgcttgggaacgctggggaactgaatgtgttaagcaa
tttatgggtttttttgctttgattgtttgggatgttgcagctaatcgtttatggttagtt
cgtgattcggtgggggtaagaactctttattattgttattcgggttcaagctattatata
gcacctaggctgaaaaatctttcttcttttcattcccaacaattagatttagtggcgctt
agagattatttatctacggcttttgttgctggtgaacgcacgttatgggaacaagttaag
gaattattacccggaacgattttaagtctatcagatggaaaaataaatagatattggcaa
cctatagagcagattttagaacccgatcaatctttggcatggtacagtaataaattacgt
gatttactagagcaagttattcgagaatatttacctcaaaatgaatctgtaggggtttat
ttatcaggggggttagattcaagttgtgttacggctttagccgctcggttacattcggct
tcagttcatacttattctattttttttggggcagatagtccccatgaattagaattttct
agtcaagttgctcaattttgtcggactgaacatcatattttagaaattacgccacaacag
atgtggaatcaattgcctgagacaatggctcatctagatgatccgattggcgatccttta
actgttcctaattatttaatggctcagttagctggaggaaatgttcaagttattcttaat
ggagaagggggtgatccttgttttgggggaccgaaaaatcagcctatgcttcttaatcaa
ttatacaatcaaacggaaaatcaatcaaatttaatgacggcttatttgacttcttttcaa
aaatgttttcttgatttgcctagattattgaaacctgatgttttagctgttgttgaatct
tcctcttttccttttgaagctgatttgaattcggagacgacttatcttaaccgcttgatg
tgcattaatattaaatttaagggagcagatcatattttaacgaaggtcaataatttaact
cgttctgctcttttggagggacgttcgcccttatttgaccggcgtattgtcgaattagcg
atgcaaattcctccgcaatataagttagctggtgcagaggaaaaagccgttttaaaacaa
gcggttattgatctattgcccatagagattattaaacgtcctaaaagtggcatgatggtt
ccggtacaattatggtttaaaaaatattggcaaagggaagcaagaaagttattattgaat
aaaaatgctaaaattgctccttactttaatcaaaaggttatacgagactggttaaactat
caaggagatccttggggacgttatggagttaagctttggttattactgagtttggagata
tggctagaagttaatcaatga

DBGET integrated database retrieval system