KEGG   Cyanothece sp. PCC 7425: Cyan7425_0213Help
Entry
Cyan7425_0213     CDS       T00836                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cyan7425_0213
Enzymes [BR:cyn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cyan7425_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
17477..19699
Genome map
AA seq 740 aa AA seqDB search
MAQQQPQLTESLQGVVERLTYHAEDSGYTVARLQSPRSRELITIVGHFSQIQPGQTLQLQ
GFWRDHPQFGAQFQVTQYRETKPATLTGIEKYLGSGLIKGVGPVTAKRIVAHFGLETLEI
IETQIERLTEVPGIARKRVRLIQSAWENQKAIKEVMLFLQEHGVSTTYAVKIFKQYGQAA
IATVGQNPYQLATDIYGIGFVTADGIARNLGIDSDSDYRYRAGLLHTLSAAAEEGHCFLP
QAELVERTAKLLQLEDYTPDPDRLLAFTTEMALTEEILMQGGSGEQQGQFICYKPAFFHA
EQNLTNRLRDLLSQPLEVDLERVRTWIARFTTAAGMALAPQQQQAVELAATQRVVVLTGG
PGTGKTFCTRTIVALWKAMGKTIALASPTGRAAQRLSEMTGQPASTLHRLLEFDPKTMNF
KRDRGNPIPAQAVVVDEASMLDLFLANSLLKAVADQAQLLLVGDCDQLPSVGPGNVLGDL
ISSGKIPVVRLTQVFRQAQSSKIVTHAHQINQGQFPPLEFVSSTPQSDCLWLAAKEPEHG
LQAIQELIQDLIPHLGFDPHRDVQVLAPMSRGLIGTRNLNQVLQSLINPSAPDKAELSQG
GVSLRVGDRVIQQVNDYDREVFNGDLGVIAAIDREEQEVTIAFGTGASVRSVKYDYADLN
EISLAWSITIHKSQGSEYPVVILPLYMQHFVLLSRNLLYTGLTRARKLAILVGPKPAIAY
AINQVKEQKRYTYLARRLTR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacaacagcctcaattaacagagtccctacagggggtagtggaacgcttgacc
taccacgccgaagactctggctataccgtagcgcgcttgcaatcaccccgcagtcgagag
ttgattacgatcgttgggcatttttcccagatccaacccgggcaaaccctacagctccag
ggcttctggcgcgatcatccccagtttggcgcccaatttcaagtgacccagtaccgcgaa
accaaacccgccaccctgactgggatcgaaaaatatctgggcagtggcttaatcaaaggg
gtggggccggtgactgccaagcgaattgtggcccactttgggctggaaaccctggagatt
attgaaactcagattgaacgcttaacggaagttcctggcattgcccgcaaacgggtcaga
ctgattcaatcggcctgggagaaccagaaagcaattaaggaggtgatgctatttctgcag
gaacacggtgtttctaccacctatgcggtgaaaatttttaagcagtacggtcaggcggcg
atcgcgacggtgggccagaacccttatcaactagccacagatatttatgggattggcttt
gtcaccgccgatgggattgcccgtaacctcggcattgattccgattcagactaccgttat
cgcgctggtctactccataccctttccgctgcagccgaggagggccattgctttttaccc
caggcggaactggtggagcgcactgctaagttgttgcagctagaggactacacgcctgat
cccgatcgcttgcttgccttcaccacagagatggctttaactgaagaaattttgatgcag
gggggaagtggagagcagcagggccagttcatttgttacaaacctgccttttttcatgcc
gagcaaaatttaacgaacaggttgcgggacttgctcagccaacccttagaagtggactta
gagcgggtgcgtacctggattgcccgatttacgactgcagcgggaatggcccttgcgcct
cagcagcaacaggcggtggaactggcggcaacccaacgtgtggtcgtgctcacgggtggc
cccggtacgggcaaaaccttttgtacccggacgatcgttgccctgtggaaagcgatgggg
aaaacgatcgccctggcttctcccaccggccgggctgcccagcggctgagtgaaatgacg
ggtcaacccgcttccaccctgcatcgtctgctagagtttgatccaaagacgatgaacttt
aagcgcgatcgcggcaatcccattcctgctcaggcggtggtggtggatgaagcctcgatg
ctggatttatttctagccaactctctcctcaaagctgttgccgatcaggcccaattgctg
ctggtgggagactgtgatcaactccccagtgtcgggccgggcaatgtgctgggagatctg
atcagcagtggtaaaattcctgtggtgcggttgactcaggtgtttcgccaggcccagtcc
agcaaaatcgtcacccatgcccaccagattaatcagggtcaattcccccctctagaattt
gtcagctccaccccccaatctgactgtctctggttggcagcaaaggaaccggaacatggt
ctgcaggcgattcaagaactgattcaggacttaattccccacctcggttttgatccccac
cgcgatgtgcaggtgctggcccccatgagccgaggactgatcggtacccgtaacctcaat
caggtgctgcaatccctgataaatccgtcggctcctgataaagcagaactaagtcagggg
ggggtaagcttacgggtgggcgatcgggtgatccagcaggtgaatgattacgatcgcgag
gtctttaatggcgatctgggggtgattgcagcgatcgatcgggaagaacaggaagtcacg
atcgcatttgggacgggagcatcggttcgatcggtgaaatacgattatgcggacttgaac
gaaatttctttagcctggagcatcacgatccataaatctcagggtagtgagtatcctgtg
gtgattctgcccctctatatgcaacattttgtcttgctcagtcgcaacctgctttacacc
ggcttgacccgcgcccgtaaactggcgattctggttggtcccaaaccggcaattgcctat
gcgatcaatcaggtcaaggaacaaaaacgctacacctacctggcccggcggctgactcgt
taa

DBGET integrated database retrieval system