KEGG   Cyanothece sp. PCC 7425: Cyan7425_0236Help
Entry
Cyan7425_0236     CDS       T00836                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00790  Folate biosynthesis
cyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan7425_0236
Enzymes [BR:cyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cyan7425_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACL42632
JGI: Cyan74250236
UniProt: B8HRX3
Position
39682..40185
Genome map
AA seq 167 aa AA seqDB search
MSLPSPLLLHQCAIALGSNLGDSQAILAAALLALAQTPGIELQRHSRLYQTTAIGPTQPD
YLNGCAILQVIHSPDQLLGILLQLEQRFGRVRRQRWGPRSLDLDLLLYDDLILSAPDLEI
PHPRMAERAFVLVPLAEIAPGWIDPRSGRSIAALAKAVDCRGIIKIL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaccttctcctctcctgctgcatcaatgtgcgatcgccctgggcagtaacctg
ggagattctcaagctatcctggctgctgctttgctggctctggcccagacaccgggaatt
gaactgcaacggcactcccgcttgtatcaaaccactgccattggcccaacccaacccgat
tatttgaatggttgtgccatcctccaggtgatccattcccccgatcagcttctagggatt
ttactgcagctcgaacaacggtttgggcgggtgcggcgacaacgctggggcccgcgatct
ctcgatttggacctgcttctctacgacgatctaattctgtctgcaccggatctggaaatt
cctcatccccgcatggcagagcgagcctttgtcctggttcccctagccgaaattgcgcct
ggctggatcgatcctcgctctggacggtcgatcgctgcgttggcaaaggctgtagactgt
aggggaatcatcaaaattctataa

DBGET integrated database retrieval system