KEGG   Cyanothece sp. PCC 7425: Cyan7425_0402Help
Entry
Cyan7425_0402     CDS       T00836                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan7425_0402
Enzymes [BR:cyn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cyan7425_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201436..202143
Genome map
AA seq 235 aa AA seqDB search
MTLASNSFNANSSNGNPNRVKGISQPRPDRNTLHGRETEIQLPPEERAKEEMMDAVRSIL
LGVGENPEREGLLKTPKRVAEAMMFLTGGYSQSLEELVNGAIFDEGHDEMVLVRDIHAFS
LCEHHMLPFIGKAHVAYIPNQKVIGLSKLARIVEMYSRRLQVQERLTRQIAEAVQTVLEP
KGVAVVMEASHMCMVMRGVQKPGSWTVTSSMLGVFKEDQKTREEFLNLIRHQPNF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgcttctaactccttcaatgccaacagtagcaacggcaatcccaaccgggtg
aagggaatatcccaaccccgccccgatcgcaataccctgcatggccgcgaaaccgagatc
caactgccaccggaagagcgggccaaagaagagatgatggatgccgttcgctcgatcctg
ctgggggtaggggagaatcccgagcgggaaggtttgctaaaaactcccaaacgggtggca
gaagccatgatgtttctcactggagggtacagccagtctctggaagagttagtcaacggg
gccatttttgatgagggccacgatgaaatggtactggtgcgcgatatccacgccttcagc
ctgtgcgaacaccatatgttgcccttcattggtaaggctcacgttgcctacatccccaac
cagaaggtgattggtctgagtaagctggcccggattgtggaaatgtattcccgccgcctt
caggtgcaggaacgcttaacccgtcaaattgccgaagcggtgcagacggtgttggaacct
aaaggagtggccgttgtgatggaagccagccatatgtgtatggtgatgcggggggtgcag
aaacccggctcctggaccgtgaccagttctatgctgggcgtgttcaaagaagaccagaaa
acccgcgaagaatttctcaacctcattcgccaccagcccaatttctaa

DBGET integrated database retrieval system