KEGG   Cyanothece sp. PCC 7425: Cyan7425_0624Help
Entry
Cyan7425_0624     CDS       T00836                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00010  Glycolysis / Gluconeogenesis
cyn00052  Galactose metabolism
cyn00500  Starch and sucrose metabolism
cyn00520  Amino sugar and nucleotide sugar metabolism
cyn00521  Streptomycin biosynthesis
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01130  Biosynthesis of antibiotics
cyn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_0624
   00052 Galactose metabolism
    Cyan7425_0624
   00500 Starch and sucrose metabolism
    Cyan7425_0624
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan7425_0624
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cyan7425_0624
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cyan7425_0624
Enzymes [BR:cyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cyan7425_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACL43013
JGI: Cyan74250624
UniProt: B8HUW6
Position
429768..430748
Genome map
AA seq 326 aa AA seqDB search
MTRWLAGDIGGTKTILRLLQTDSPIVAEKTYPSASYPHLNPIIKDFLAEVGGEGPQAACL
AIAGPVINNTCQLSNLHWLLDGEEMQASLGIPHVQLINDFVAVGYGILGLHPDDLVVLQD
QPAVPEGTIAVLGAGTGLGEALLFWERDQYKVIALEGGHTDFAARNPLEIGLLQFLLQQH
QRVSVERVVSGMGIPVIYQYLRQSQFAPESPIVAAALAQEDAAAVIARHALAKTDRLCEQ
TLEMFVAAYGAEAGNLALKSLPSGGVYIAGGVAPKILAKMEDGTFMANFLNKGRMRPLLE
KMRVSLILNPKVGLLGAGLLAERLQP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactagatggttggctggagatattggcggaacgaaaacaattttgcgcctacttcag
acagattccccgattgtggcagaaaaaacctaccccagtgcctcctaccctcacctgaat
cccatcattaaagattttctggcggaagtggggggagaggggccccaggcagcctgtctg
gcgattgctggtcctgtgatcaataacacctgtcaactcagtaatttgcattggttgctg
gatggggaggaaatgcaagccagcctgggcattccccacgtgcagttgattaatgatttt
gtcgccgttggctatggcattttggggttgcacccggacgatttagtggttttgcaagat
caaccggctgtaccagaggggacgatcgcagttctgggggcggggacaggattgggggaa
gctctgctgttctgggagcgggatcaatataaagttattgccctggaaggcggacacacg
gactttgcggctcgtaaccccttagaaattggtttacttcagtttctcttacaacagcat
cagcgggtttcagtggaacgggtggtttccggtatgggtatccctgtgatttatcaatac
ctgcgtcaaagccagtttgcccctgaatcgcccatagttgccgctgccctggcccaggaa
gatgctgctgcggtgattgctcggcacgccctggccaaaaccgatcgcctctgtgagcaa
accctggagatgttcgttgccgcctatggagcggaagccggaaatttagctttgaaaagc
ttaccttctggaggagtctatatcgccggaggggttgcccctaaaattctggccaaaatg
gaggatggcacctttatggctaactttctgaataaaggcagaatgcgtcccctgctggaa
aaaatgcgtgtttccctgatcctcaatcccaaagttggcttgttaggggcaggattactg
gcagagcgattacaaccttag

DBGET integrated database retrieval system